DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr54B and khdrbs3

DIOPT Version :9

Sequence 1:NP_001261050.1 Gene:qkr54B / 36966 FlyBaseID:FBgn0022987 Length:617 Species:Drosophila melanogaster
Sequence 2:XP_002932263.1 Gene:khdrbs3 / 100379996 XenbaseID:XB-GENE-941483 Length:342 Species:Xenopus tropicalis


Alignment Length:323 Identity:129/323 - (39%)
Similarity:180/323 - (55%) Gaps:66/323 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 EYIRDCMAERNRMDRKFPIAEKLLEGEIEKVQTTGRIPSREQKYADIYREKPLRISQRVLVPIRE 131
            :|:...:||::.:|..|..|.::::.||||:| .|. .:.|.:|.|:...|.::::|:||:||::
 Frog     3 KYLPQLLAEKDALDPSFTHALRMVKEEIEKLQ-KGE-DNTEDQYIDVVINKNMKLAQKVLIPIKQ 65

  Fly   132 HPKFNFVGKLLGPKGNSLRRLQEETLCKMTVLGRNSMRDRVKEEELRSSKDPKYAHLNSDLHVEI 196
            .||||||||||||:||||:||||:||.||::||:.||||:.||||||.|.:.||.|||.||||.|
 Frog    66 FPKFNFVGKLLGPRGNSLKRLQEDTLTKMSILGKGSMRDKAKEEELRKSGEAKYYHLNDDLHVLI 130

  Fly   197 STIAPPAEAYARIAYAMAELRKYLIPDSNDIIRQEQLRELMDSTSLNDNDNAKSGYKKTSH---M 258
            ...|||||||||:.:|:.|::|:||||.||.|||.||:||   |.||       |..:|:.   :
 Frog   131 EVFAPPAEAYARMGHALEEIKKFLIPDYNDEIRQAQLQEL---TYLN-------GGPETTEAPVV 185

  Fly   259 QGGNNVLGGGSINPI-----GGVKNTPHHSYRSSQPSSFSKNVLAPKQKVMSILEKART------ 312
            :|..::...|...|.     |||         ...|:...:...||:....:.:..||.      
 Frog   186 RGKPSIRARGVPVPALPRGRGGV---------PPAPTGVPRGAPAPRGVTPARVSSARARGLVAT 241

  Fly   313 ---------------AMDETYGR-GYDDGLG--YDPHQSYDSY------------SYGTHGHG 345
                           .:.:|||. .||||.|  || .||||||            .|..:|||
 Frog   242 RARGIPPPAGYRPPPPVQDTYGEYDYDDGYGTAYD-EQSYDSYDNNYNSQGQSTADYYDYGHG 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr54BNP_001261050.1 Qua1 68..117 CDD:292891 15/48 (31%)
SF1_like-KH 122..237 CDD:239088 76/114 (67%)
khdrbs3XP_002932263.1 Qua1 3..52 CDD:374463 15/50 (30%)
SF1_like-KH 57..176 CDD:239088 80/128 (63%)
PHA03381 <193..>233 CDD:177618 8/48 (17%)
Sam68-YY 262..316 CDD:374636 19/43 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I7806
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4780
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9347
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1163
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.020

Return to query results.
Submit another query.