DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and LHX4

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_203129.1 Gene:LHX4 / 89884 HGNCID:21734 Length:390 Species:Homo sapiens


Alignment Length:167 Identity:46/167 - (27%)
Similarity:67/167 - (40%) Gaps:29/167 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   585 ASIPGIEDMNMYPSCAGMP-EQFQQLRLHGDEASGKNSTRTILCADCNQPIAMGEVAVKADRAGK 648
            |::|....:...|...|:| :|..|                  ||.|||.|....:....||   
Human     5 ATVPAEGAVKGLPEMLGVPMQQIPQ------------------CAGCNQHILDKFILKVLDR--- 48

  Fly   649 EIAWHPGCFKCITCRELLADLVYFFHQGQVFCGRDLAIRLKIPRCRACDELI-FTKEYTAAEEAT 712
              .||..|.||..|:..|||.. |...|.|:|..|...|.. .:|.||.:.| .|:....|::..
Human    49 --HWHSSCLKCADCQMQLADRC-FSRAGSVYCKEDFFKRFG-TKCTACQQGIPPTQVVRKAQDFV 109

  Fly   713 FHIKHFCCYQCDEPLA-GQQYIADEKSNMPLCLLCYD 748
            :|:..|.|..|:..|| |.::...|...: :|...|:
Human   110 YHLHCFACIICNRQLATGDEFYLMEDGRL-VCKEDYE 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604
LIM1_Testin_like 627..684 CDD:188726 21/56 (38%)
LIM2_Testin_like 691..748 CDD:188727 15/58 (26%)
LIM 755..810 CDD:295319
LHX4NP_203129.1 LIM1_Lhx4 30..81 CDD:188852 21/56 (38%)
LIM2_Lhx3_Lhx4 89..144 CDD:188762 15/55 (27%)
Homeobox 160..213 CDD:306543
Interaction with DNA. /evidence=ECO:0000305|PubMed:28473536 161..181
Interaction with 5-mCpG DNA. /evidence=ECO:0000305|PubMed:28473536 199..211
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 230..253
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 356..390
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.