DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and LRG1

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_010041.2 Gene:LRG1 / 851358 SGDID:S000002399 Length:1017 Species:Saccharomyces cerevisiae


Alignment Length:178 Identity:45/178 - (25%)
Similarity:69/178 - (38%) Gaps:29/178 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   619 KNSTRTILCADCNQPIAMGEVAVKADRAGKEIAWHPGCFKCITCRELLADLVYFFHQ------GQ 677
            ||..:  :||.||:.:.......|.........:|..||.|..|::.|.. .||.:|      ..
Yeast    22 KNQKK--ICARCNKLVIPDSQRTKTTLKALGKYYHESCFTCQDCQKPLKP-KYFPYQVDKTSESI 83

  Fly   678 VFCGRDLAIRLKIPRCRACDELIFTKEYTA-----AEEATFHIKHFCCYQCDEPLAGQQYIADEK 737
            :.|..|...|..: .|..||..:....|||     .||      ||.|..|..|...::...  .
Yeast    84 LLCQYDYFRRHNL-LCHVCDTPLRGLYYTAFGYRYDEE------HFSCTICATPCGVKKCFM--Y 139

  Fly   738 SNMPLCLLCYDRLFAVRCQRCKVAIGPADQGVAW---GDVH-WHASCF 781
            .|...|...:.:.|:.||:.|:..|  :||.:.:   .::| ||..|:
Yeast   140 GNQLYCKYHFLKYFSKRCKGCEFPI--SDQYIEFPKGEEIHCWHPECY 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604
LIM1_Testin_like 627..684 CDD:188726 15/62 (24%)
LIM2_Testin_like 691..748 CDD:188727 15/61 (25%)
LIM 755..810 CDD:295319 9/31 (29%)
LRG1NP_010041.2 LIM1_Lrg1p_like 28..90 CDD:188777 15/62 (24%)
LIM 98..149 CDD:259829 15/58 (26%)
LIM3_Lrg1p_like 419..475 CDD:188779
RhoGAP_fLRG1 728..959 CDD:239862
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.