DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and ATHB13

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_177136.1 Gene:ATHB13 / 843314 AraportID:AT1G69780 Length:294 Species:Arabidopsis thaliana


Alignment Length:277 Identity:56/277 - (20%)
Similarity:89/277 - (32%) Gaps:106/277 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   380 GAQMRQDTPMRRVKFGGVSTIVYDCGLPANTDYDRDPVFAQILQAEPLKHA--FQEARAG----- 437
            |:||.:  ..||:....|.|:..:..|....:.:|....|:.|..:|.:.|  ||..||.     
plant    79 GSQMGE--KKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQ 141

  Fly   438 ---------------RAPSSVVISNIPAPVASLAELRGLNPATRAQLQSVGLDKNMLQSAVSNAP 487
                           :|.:.::.::   .....||:.||.  .|.|.:|:.|:|. .:.:.||  
plant   142 LEKDYDTLKRQFDTLKAENDLLQTH---NQKLQAEIMGLK--NREQTESINLNKE-TEGSCSN-- 198

  Fly   488 YYDRLFRSLHDKGISHDQCHLLQPMKQVHDWLLDDDQLLDEIDKVFADMANGCKDISYPKPSLGE 552
                  ||.:    |.|...|                                 |||...||   
plant   199 ------RSDN----SSDNLRL---------------------------------DISTAPPS--- 217

  Fly   553 LPTSQSSDSGFHSKPPTPGYGSEDLTAGQGRFASIPGIEDMNMYPSCAGMPEQFQQLRLHGDEAS 617
               :.|:.:|.|..||.        |.|:..|.           ||.|........::...:.:|
plant   218 ---NDSTLTGGHPPPPQ--------TVGRHFFP-----------PSPATATTTTTTMQFFQNSSS 260

  Fly   618 G------KNSTRTILCA 628
            |      :||...:.||
plant   261 GQSMVKEENSISNMFCA 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604
LIM1_Testin_like 627..684 CDD:188726 2/2 (100%)
LIM2_Testin_like 691..748 CDD:188727
LIM 755..810 CDD:295319
ATHB13NP_177136.1 Homeobox 85..138 CDD:395001 14/52 (27%)
HALZ 140..182 CDD:396657 6/46 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.