DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and DAR2

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_001324813.1 Gene:DAR2 / 818570 AraportID:AT2G39830 Length:531 Species:Arabidopsis thaliana


Alignment Length:331 Identity:71/331 - (21%)
Similarity:111/331 - (33%) Gaps:111/331 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   484 SNAPYYD----------RLFRSLHDKGIS--HDQCHLLQPMKQVHDWLLDDDQLL-----DEIDK 531
            |::.|.|          :||:|..:.|.|  |...|  .|..|      :|:.::     ..:| 
plant    37 SSSTYRDKKWKLMKWVSKLFKSGSNGGGSGAHTNHH--PPQFQ------EDENMVFPLPPSSLD- 92

  Fly   532 VFADMANGCKDISYPKPSLGELPTSQSSDSGFHSKPPTPGYG-SEDLTAGQGRFASIPGIEDMNM 595
               |.:.|.:|..       ||..|.|.....::|.| .||| |.|......|            
plant    93 ---DRSRGARDKE-------ELDRSISLSLADNTKRP-HGYGWSMDNNRDFPR------------ 134

  Fly   596 YPSCAGM-PEQFQQLRLHGDEASGKNSTRTILCADCNQPIAMGEVAVKADRAGKEIAWHPGCFKC 659
             |...|: |..|    :...|.|.:...|..:|..||..|..|...     ......:||.||:|
plant   135 -PFHGGLNPSSF----IPPYEPSYQYRRRQRICGGCNSDIGSGNYL-----GCMGTFFHPECFRC 189

  Fly   660 ITCRELLADLVYF------FHQGQVFCGRDLAIRLKIPRCRACDELIFTKEYTAAEEATFHIKHF 718
            .:|...:.:..:.      :|:   .|.::|.    .|:|..|...|.|.:....|         
plant   190 HSCGYAITEHEFSLSGTKPYHK---LCFKELT----HPKCEVCHHFIPTNDAGLIE--------- 238

  Fly   719 CCYQCDEPLAGQQYIADEKSNMPLCLLCYDRLFAVRCQRCKVAIGPADQGVAWGDVHWH------ 777
              |:| .|...|:|....:         ||:  ..||..|       ::..:| ||.::      
plant   239 --YRC-HPFWNQKYCPSHE---------YDK--TARCCSC-------ERLESW-DVRYYTLEDGR 281

  Fly   778 ASCFVC 783
            :.|..|
plant   282 SLCLEC 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604
LIM1_Testin_like 627..684 CDD:188726 13/62 (21%)
LIM2_Testin_like 691..748 CDD:188727 11/56 (20%)
LIM 755..810 CDD:295319 7/35 (20%)
DAR2NP_001324813.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.