powered by:
Protein Alignment Tes and LIMD2
DIOPT Version :9
Sequence 1: | NP_611215.1 |
Gene: | Tes / 36965 |
FlyBaseID: | FBgn0034223 |
Length: | 816 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_085053.1 |
Gene: | LIMD2 / 80774 |
HGNCID: | 28142 |
Length: | 127 |
Species: | Homo sapiens |
Alignment Length: | 54 |
Identity: | 15/54 - (27%) |
Similarity: | 26/54 - (48%) |
Gaps: | 1/54 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 682 RDLAIRLKIPR-CRACDELIFTKEYTAAEEATFHIKHFCCYQCDEPLAGQQYIA 734
:..::|.::.. |.||.:.::..|...|::..||...|||..|...|:...|.|
Human 28 KSFSLRAQVKETCAACQKTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAA 81
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165158512 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.