DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and prickle2a

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_001071251.2 Gene:prickle2a / 777736 ZFINID:ZDB-GENE-061110-112 Length:869 Species:Danio rerio


Alignment Length:221 Identity:91/221 - (41%)
Similarity:129/221 - (58%) Gaps:20/221 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   604 EQFQQLRLHGDEAS----GKNSTRTI-------LCADCNQPIAMGEVAVKADRAGKEIAWHPGCF 657
            |:.::|::..::..    |:.:.|.:       :|..|.:.|..|::||.|.|....:.|||.||
Zfish    92 EEKRELKIFSNQRKRDNLGRGTVRPLPLTITGAICQQCGEQIKGGDIAVFASRVAHGLCWHPHCF 156

  Fly   658 KCITCRELLADLVYFFHQGQVFCGRDLAIRLKIPRCRACDELIFTKEYTAAEEATFHIKHFCCYQ 722
            .|..|.|||.||:||..:|:::|||..|.||| |||.||||:||..|.|.||...:|:||||||:
Zfish   157 VCGVCSELLVDLIYFQLEGKIYCGRHHAERLK-PRCSACDEIIFADECTEAEGQHWHMKHFCCYE 220

  Fly   723 CDEPLAGQQYIADEKSNMPLCLLCYDRLFAVRCQRCKVAIGPADQG-VAWGDVHWHAS--CFVCA 784
            |:.||.||:||..|  ..|.|..|::.|:|..|..|...|| .||| :.:...||||:  ||.||
Zfish   221 CEAPLGGQRYIMRE--GHPHCCNCFENLYAEYCDSCGEHIG-IDQGQMTYEGQHWHATEDCFSCA 282

  Fly   785 GVQCSKPLIGGRFCVKENMPFCSPTC 810
              :||:.|:|..|..|:.:.:||..|
Zfish   283 --RCSQSLLGRPFLPKQGLIYCSRLC 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604
LIM1_Testin_like 627..684 CDD:188726 26/56 (46%)
LIM2_Testin_like 691..748 CDD:188727 31/56 (55%)
LIM 755..810 CDD:295319 23/57 (40%)
prickle2aNP_001071251.2 PET_Prickle 22..118 CDD:193602 4/25 (16%)
LIM1_Prickle 126..184 CDD:188799 26/57 (46%)
LIM2_Prickle 189..244 CDD:188802 31/56 (55%)
LIM3_Prickle 249..307 CDD:188804 24/61 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11801
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422310at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.