DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and Fhl5

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_001342427.1 Gene:Fhl5 / 57756 MGIID:1913192 Length:284 Species:Mus musculus


Alignment Length:188 Identity:53/188 - (28%)
Similarity:76/188 - (40%) Gaps:26/188 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   627 CADCNQPIAMGEVAVKADRAGKEIAWHPGCFKCITCRELLADLVYFFHQGQVFCGRDLAIRLKIP 691
            |..|.:||.    :...|...|...||.|||:|..|...|.:..:.....::.| .|........
Mouse    41 CEQCKEPIE----SDSKDLCYKNRHWHEGCFRCNKCHHSLVEKPFVAKDDRLLC-TDCYSNECSS 100

  Fly   692 RCRACDELI--------FTKEYTAAEEATFHIKHFCCYQCDEPLAGQQYIADEKSNMPLCLLCYD 748
            :|..|...|        |...|       :|...|.|..|.:|:..:..|:.|..|  .|:.|::
Mouse   101 KCFHCKRTIMPGSRKMEFKGNY-------WHETCFVCEHCRQPIGTKPLISKESGN--YCVPCFE 156

  Fly   749 RLFAVRCQRCKVAIGPADQGVAWGDVHWHASCFVCAGVQCSKPLIGGRFCVKENMPFC 806
            :.||..|..||..|  ...|:.:.|..||..||:|:|  |.|.|....|..|::.|||
Mouse   157 KEFAHYCNFCKKVI--TSGGITFRDQIWHKECFLCSG--CRKELYEEAFMSKDDFPFC 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604
LIM1_Testin_like 627..684 CDD:188726 15/56 (27%)
LIM2_Testin_like 691..748 CDD:188727 15/64 (23%)
LIM 755..810 CDD:295319 20/52 (38%)
Fhl5NP_001342427.1 LIM <3..34 CDD:413332
LIM1_FHL 37..95 CDD:188729 16/58 (28%)
LIM2_FHL5 102..155 CDD:188812 14/61 (23%)
LIM 163..214 CDD:413332 20/52 (38%)
LIM4_FHL 222..277 CDD:188733
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.