DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and limd2

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:XP_009297834.1 Gene:limd2 / 560139 ZFINID:ZDB-GENE-120906-1 Length:131 Species:Danio rerio


Alignment Length:42 Identity:13/42 - (30%)
Similarity:20/42 - (47%) Gaps:0/42 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   693 CRACDELIFTKEYTAAEEATFHIKHFCCYQCDEPLAGQQYIA 734
            |.:|::.::..|...|....||...|||..|:..|:...|.|
Zfish    44 CASCEKTVYPMERLVANNLIFHAACFCCKHCNTKLSLGSYAA 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604
LIM1_Testin_like 627..684 CDD:188726
LIM2_Testin_like 691..748 CDD:188727 13/42 (31%)
LIM 755..810 CDD:295319
limd2XP_009297834.1 LIM_Eplin_like_1 44..96 CDD:188870 13/42 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594462
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.