powered by:
Protein Alignment Tes and limd2
DIOPT Version :9
Sequence 1: | NP_611215.1 |
Gene: | Tes / 36965 |
FlyBaseID: | FBgn0034223 |
Length: | 816 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_009297834.1 |
Gene: | limd2 / 560139 |
ZFINID: | ZDB-GENE-120906-1 |
Length: | 131 |
Species: | Danio rerio |
Alignment Length: | 42 |
Identity: | 13/42 - (30%) |
Similarity: | 20/42 - (47%) |
Gaps: | 0/42 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 693 CRACDELIFTKEYTAAEEATFHIKHFCCYQCDEPLAGQQYIA 734
|.:|::.::..|...|....||...|||..|:..|:...|.|
Zfish 44 CASCEKTVYPMERLVANNLIFHAACFCCKHCNTKLSLGSYAA 85
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170594462 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.