DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and lmo7b

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_001038909.2 Gene:lmo7b / 558333 ZFINID:ZDB-GENE-060825-242 Length:1384 Species:Danio rerio


Alignment Length:172 Identity:48/172 - (27%)
Similarity:68/172 - (39%) Gaps:40/172 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   549 SLGELPTS-----QSSDSGFHSKP-----PTPGY--GSEDLTAGQGRFASIPGIEDMNMYPSCAG 601
            |:..|.|:     ||..||..|:|     .:..|  |...|..|...|::...:......|...|
Zfish  1230 SMDNLHTTNSWSRQSYTSGLSSRPHSALGSSGSYRSGRSSLGPGSAIFSTGVKLNSNTTTPEPPG 1294

  Fly   602 M---PEQFQQLRLHGDEASGKNSTRTILCADCNQPIAMGEVAVKADRAGKEIAWHPGCFKCITCR 663
            :   |...||.||    .||:.     :|:.|.||:..| .|:..|  ..|:.:|.|||||::||
Zfish  1295 LESRPNSQQQGRL----VSGRR-----MCSRCEQPLGKG-AAMVID--SLELCFHIGCFKCVSCR 1347

  Fly   664 ELL------ADLVYFFHQGQVFCGRDLAIRLKIPRCRACDEL 699
            ..|      ...|...|: |:||.....      |.|.|..:
Zfish  1348 TELGRGPESGAQVRVRHR-QLFCNTCYC------RIRVCSSI 1382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604
LIM1_Testin_like 627..684 CDD:188726 22/62 (35%)
LIM2_Testin_like 691..748 CDD:188727 3/9 (33%)
LIM 755..810 CDD:295319
lmo7bNP_001038909.2 CH 16..129 CDD:237981
DUF4757 418..579 CDD:292571
PDZ_serine_protease <851..912 CDD:238487
SDP_N 1019..>1102 CDD:289079
GBP_C <1019..1057 CDD:303769
LIM 1314..1373 CDD:259829 22/62 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.