DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and LIMS2

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_060450.2 Gene:LIMS2 / 55679 HGNCID:16084 Length:365 Species:Homo sapiens


Alignment Length:283 Identity:79/283 - (27%)
Similarity:112/283 - (39%) Gaps:44/283 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   550 LGELPTSQSSDSGFHSKPPTPGYGS-EDLTAG------QGRFASIPGIEDMN--MYPS----CAG 601
            ||.|..|.......|.:.|.|..|: .|..|.      |.||:....|.:.|  :|..    ||.
Human     5 LGALAASGLYRRRQHRQSPPPATGNMSDALANAVCQRCQARFSPAERIVNSNGELYHEHCFVCAQ 69

  Fly   602 MPEQFQQLRLHGDEASGKNSTR-------TILCADCNQPIAMGEVAVKADRAGKEIAWHPGCFKC 659
            ....|.:...:  |..|:....       ...|..|.:.| :|.| :||....    ||||||:|
Human    70 CFRPFPEGLFY--EFEGRKYCEHDFQMLFAPCCGSCGEFI-IGRV-IKAMNNN----WHPGCFRC 126

  Fly   660 ITCRELLADLVYFFHQGQVFC----GRDLAIRLKIPRCRACDELIFTKEYTAAEEATFHIKHFCC 720
            ..|...||||.:..:.|:..|    .|:.|..|....|:.| .|:..::........:|..||.|
Human   127 ELCDVELADLGFVKNAGRHLCRPCHNREKAKGLGKYICQRC-HLVIDEQPLMFRSDAYHPDHFNC 190

  Fly   721 YQCDEPLAGQQYIADEKSNMPLCLLCYDRLFAVRCQRCKVAIGPADQGV--AWGDVHWHASCFVC 783
            ..|.:.|..:   |.|......||.|:|::....|..|:   .|.:..|  |.|. .||...|||
Human   191 THCGKELTAE---ARELKGELYCLPCHDKMGVPICGACR---RPIEGRVVNALGK-QWHVEHFVC 248

  Fly   784 AGVQCSKPLIGGRFCVKENMPFC 806
            |  :|.||.:|.|...|:.:.:|
Human   249 A--KCEKPFLGHRHYEKKGLAYC 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604
LIM1_Testin_like 627..684 CDD:188726 22/60 (37%)
LIM2_Testin_like 691..748 CDD:188727 14/56 (25%)
LIM 755..810 CDD:295319 19/54 (35%)
LIMS2NP_060450.2 LIM1_PINCH 39..97 CDD:188717 11/59 (19%)
LIM2_PINCH 100..151 CDD:188718 21/56 (38%)
LIM3_PINCH 164..214 CDD:188719 13/53 (25%)
LIM4_PINCH 220..273 CDD:188720 19/56 (34%)
LIM5_PINCH 281..334 CDD:188721
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.