DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and fhl3b

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_001093448.1 Gene:fhl3b / 555053 ZFINID:ZDB-GENE-030131-8356 Length:290 Species:Danio rerio


Alignment Length:206 Identity:53/206 - (25%)
Similarity:81/206 - (39%) Gaps:39/206 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   610 RLHGDEASGKNSTRTILCADCNQPIAMGEVAVKADRAGKEI-----AWHPGCFKCITCRELLADL 669
            |||.:           .|.:|.:.|         :...:|:     .:|..||:|..|...||..
Zfish    34 RLHAN-----------TCHECKELI---------EHNSRELYHEDRHYHEQCFRCSRCSRSLAKE 78

  Fly   670 VYFFHQGQVFCGRDLAIRLKIPRCRACDELIF----TKEYTAAEEATFHIKHFCCYQCDEPLAGQ 730
            .:...:..:.|......... ..|.||.:.:.    ..||   |:..:|.:.|.|..|::|:..|
Zfish    79 SFTCQEDALVCNNCYCNEFS-SNCVACGKTVMPGSKRLEY---EDCVWHEECFVCCGCEQPIGAQ 139

  Fly   731 QYIADEKSNMPLCLLCYDRLFAVRCQRCKVAIGPADQGVAWGDVHWHASCFVCAGVQCSKPLIGG 795
            .:|.|:...  .|:.||:..||.||..||..:  ...||.:.|..||..||:|.|  |...|.|.
Zfish   140 SFIPDKDEY--YCVPCYEGRFAPRCAHCKQTL--VQGGVTYRDEPWHKECFLCTG--CKVQLAGQ 198

  Fly   796 RFCVKENMPFC 806
            .|..:...|:|
Zfish   199 PFTTQGEDPYC 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604
LIM1_Testin_like 627..684 CDD:188726 12/61 (20%)
LIM2_Testin_like 691..748 CDD:188727 16/60 (27%)
LIM 755..810 CDD:295319 18/52 (35%)
fhl3bNP_001093448.1 LIM <5..33 CDD:295319
LIM1_FHL3 36..94 CDD:188807 13/77 (17%)
LIM2_FHL3 98..155 CDD:188811 16/62 (26%)
LIM3_FHL 162..213 CDD:188732 18/52 (35%)
LIM4_FHL3 221..276 CDD:188818
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.