Sequence 1: | NP_611215.1 | Gene: | Tes / 36965 | FlyBaseID: | FBgn0034223 | Length: | 816 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001093448.1 | Gene: | fhl3b / 555053 | ZFINID: | ZDB-GENE-030131-8356 | Length: | 290 | Species: | Danio rerio |
Alignment Length: | 206 | Identity: | 53/206 - (25%) |
---|---|---|---|
Similarity: | 81/206 - (39%) | Gaps: | 39/206 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 610 RLHGDEASGKNSTRTILCADCNQPIAMGEVAVKADRAGKEI-----AWHPGCFKCITCRELLADL 669
Fly 670 VYFFHQGQVFCGRDLAIRLKIPRCRACDELIF----TKEYTAAEEATFHIKHFCCYQCDEPLAGQ 730
Fly 731 QYIADEKSNMPLCLLCYDRLFAVRCQRCKVAIGPADQGVAWGDVHWHASCFVCAGVQCSKPLIGG 795
Fly 796 RFCVKENMPFC 806 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Tes | NP_611215.1 | PET_testin | 110..197 | CDD:193604 | |
LIM1_Testin_like | 627..684 | CDD:188726 | 12/61 (20%) | ||
LIM2_Testin_like | 691..748 | CDD:188727 | 16/60 (27%) | ||
LIM | 755..810 | CDD:295319 | 18/52 (35%) | ||
fhl3b | NP_001093448.1 | LIM | <5..33 | CDD:295319 | |
LIM1_FHL3 | 36..94 | CDD:188807 | 13/77 (17%) | ||
LIM2_FHL3 | 98..155 | CDD:188811 | 16/62 (26%) | ||
LIM3_FHL | 162..213 | CDD:188732 | 18/52 (35%) | ||
LIM4_FHL3 | 221..276 | CDD:188818 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X39 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |