DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and POU3F4

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_000298.3 Gene:POU3F4 / 5456 HGNCID:9217 Length:361 Species:Homo sapiens


Alignment Length:272 Identity:57/272 - (20%)
Similarity:82/272 - (30%) Gaps:93/272 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 DPKLGPIAEFRKEYV-------NNPQFRAEINTICPQPPMTPIKSPPGTPFN------------- 366
            |.:||.|...|..:|       |:|      |.....|...|..:..|.|.|             
Human    87 DLQLGAIIHHRSPHVAHHSPHTNHP------NAWGASPAPNPSITSSGQPLNVYSQPGFTVSGML 145

  Fly   367 -----------------SPLPLKNPVQIRMGAQMRQD-----TP-------------MRRVKFGG 396
                             .|:..:.|....:|:...||     ||             .||:|.|.
Human   146 EHGGLTPPPAAASAQSLHPVLREPPDHGELGSHHCQDHSDEETPTSDELEQFAKQFKQRRIKLGF 210

  Fly   397 VSTIVYDCGLPANTDYDRDPVFAQ--ILQAEPLKHAFQEARAGRAPSSVVISNIPAPVASLAELR 459
            ...   |.||...|.|..  ||:|  |.:.|.|:.:|:.                  :..|..| 
Human   211 TQA---DVGLALGTLYGN--VFSQTTICRFEALQLSFKN------------------MCKLKPL- 251

  Fly   460 GLNPATRAQLQSVGLDKNMLQSAVSNAPYYDRLFRSLHDKGISHDQCHLL---QPMKQVHDWLLD 521
             ||........|.|...::.:.|........|....:..||:.  :.|.|   :|..|....|.|
Human   252 -LNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGVL--ETHFLKCPKPAAQEISSLAD 313

  Fly   522 DDQLLDEIDKVF 533
            ..||..|:.:|:
Human   314 SLQLEKEVVRVW 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604
LIM1_Testin_like 627..684 CDD:188726
LIM2_Testin_like 691..748 CDD:188727
LIM 755..810 CDD:295319
POU3F4NP_000298.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 99..131 7/37 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..192 7/47 (15%)
POU 186..260 CDD:197673 22/98 (22%)
Homeobox 281..335 CDD:365835 13/47 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.