Sequence 1: | NP_611215.1 | Gene: | Tes / 36965 | FlyBaseID: | FBgn0034223 | Length: | 816 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_000298.3 | Gene: | POU3F4 / 5456 | HGNCID: | 9217 | Length: | 361 | Species: | Homo sapiens |
Alignment Length: | 272 | Identity: | 57/272 - (20%) |
---|---|---|---|
Similarity: | 82/272 - (30%) | Gaps: | 93/272 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 322 DPKLGPIAEFRKEYV-------NNPQFRAEINTICPQPPMTPIKSPPGTPFN------------- 366
Fly 367 -----------------SPLPLKNPVQIRMGAQMRQD-----TP-------------MRRVKFGG 396
Fly 397 VSTIVYDCGLPANTDYDRDPVFAQ--ILQAEPLKHAFQEARAGRAPSSVVISNIPAPVASLAELR 459
Fly 460 GLNPATRAQLQSVGLDKNMLQSAVSNAPYYDRLFRSLHDKGISHDQCHLL---QPMKQVHDWLLD 521
Fly 522 DDQLLDEIDKVF 533 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Tes | NP_611215.1 | PET_testin | 110..197 | CDD:193604 | |
LIM1_Testin_like | 627..684 | CDD:188726 | |||
LIM2_Testin_like | 691..748 | CDD:188727 | |||
LIM | 755..810 | CDD:295319 | |||
POU3F4 | NP_000298.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 99..131 | 7/37 (19%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 144..192 | 7/47 (15%) | |||
POU | 186..260 | CDD:197673 | 22/98 (22%) | ||
Homeobox | 281..335 | CDD:365835 | 13/47 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |