DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and Mlp84B

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_001303418.1 Gene:Mlp84B / 40849 FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster


Alignment Length:280 Identity:62/280 - (22%)
Similarity:89/280 - (31%) Gaps:103/280 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   607 QQLRLHGDEASGKNST----RTIL-------CADCNQPIAMGEVAVKADRAGKEIAWHPGCFKCI 660
            |.||.:||..|.:|..    |.|.       |..|...:...|..:...|     :||..||||.
  Fly    89 QFLRENGDVPSVRNGARLEPRAIARAPEGEGCPRCGGYVYAAEQMLARGR-----SWHKECFKCG 148

  Fly   661 TCRELLADLV-----------------------YFFHQG------QVFCGRDLA--IRLKI---- 690
            ||::.|..::                       |.:.||      ..:...|.|  ||..|    
  Fly   149 TCKKGLDSILCCEAPDKNIYCKGCYAKKFGPKGYGYGQGGGALQSDCYAHDDGAPQIRAAIDVDK 213

  Fly   691 ------PRCRACDELIFTKEYTAAEEATFHIKHFCCYQCDEPLAGQQYIADEKSNMPLCLLCY-- 747
                  ..|..|..:::..|...::...:|.|.|.|..|.:.|.... .:|.......|..||  
  Fly   214 IQARPGEGCPRCGGVVYAAEQKLSKGREWHKKCFNCKDCHKTLDSIN-ASDGPDRDVYCRTCYGK 277

  Fly   748 -----------------------DRLFAVR-----------------CQRCKVAIGPADQGVAWG 772
                                   |::.|.|                 |.||..|:..|:|.::.|
  Fly   278 KWGPHGYGFACGSGFLQTDGLTEDQISANRPFYNPDTTSIKARDGEGCPRCGGAVFAAEQQLSKG 342

  Fly   773 DVHWHASCFVCAGVQCSKPL 792
            .| ||..|:.||  .|.:||
  Fly   343 KV-WHKKCYNCA--DCHRPL 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604
LIM1_Testin_like 627..684 CDD:188726 16/85 (19%)
LIM2_Testin_like 691..748 CDD:188727 13/81 (16%)
LIM 755..810 CDD:295319 16/38 (42%)
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788
LIM_CRP_like 120..173 CDD:188712 13/57 (23%)
LIM_CRP_like 222..275 CDD:188712 11/53 (21%)
LIM_CRP_like 325..378 CDD:188712 16/38 (42%)
LIM_CRP_like 421..474 CDD:188712
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.