DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and pdlim7

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_957134.1 Gene:pdlim7 / 393813 ZFINID:ZDB-GENE-040426-2092 Length:419 Species:Danio rerio


Alignment Length:303 Identity:80/303 - (26%)
Similarity:119/303 - (39%) Gaps:62/303 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   541 KDISYP-KPSLGELPTSQSSDSGFHSKPPTPGYGSEDLTAGQGRFASIPGIEDMNMYPSC----- 599
            |.:||. ||:|       ||....|...|.| ...:...|.:......|....::..|:|     
Zfish   134 KPVSYALKPAL-------SSPHNGHGVAPCP-VTVKSKPADKHDAVQAPAKAPVSSGPACRPPWV 190

  Fly   600 --AGMPEQFQQLRLHGDEAS-----------------------------GKNSTRTILCADCNQP 633
              .|..:     |.|.|::|                             ..:||.|.|||.|:: 
Zfish   191 TDPGFAD-----RYHPDKSSTVVTQHTQPLQPTPMQNRSSILQAAQQSPAHSSTATPLCAACSK- 249

  Fly   634 IAMGEVAVKADRAGKEIAWHPGCFKCITCRELLADLVYFFHQGQVFCGRDLAIRLKIPRCRACDE 698
            |..|...|...|     :|||..|.|..|:.||.:..:|..:|.::|.:....|.. |.|..|.:
Zfish   250 IIRGRYVVALGR-----SWHPEEFMCCQCKRLLDEGGFFEEKGSIYCSKCYDNRYS-PNCAKCKK 308

  Fly   699 LIFTKEYTAAEEATFHIKHFCCYQCDEPLAGQQYIADEKSNMPLCLLCYDRLFAVRCQRCKVAIG 763
            :| |.|...|.:.|:|::.|.|..|..|:..|.:..:|  ..|.|...|:::|..:|..|...|.
Zfish   309 II-TGEIMHALKMTYHVQCFLCAACKLPIRNQAFYMEE--GEPYCERDYEKMFGTKCHGCDFKID 370

  Fly   764 PADQGVAWGDVHWHASCFVCAGVQCSKPLIGGRFCVKENMPFC 806
            ..|:.:......||.:|||||  .|...|.|..|..|::.|.|
Zfish   371 AGDRFLEALGYSWHDTCFVCA--ICQINLEGKTFYSKKDKPLC 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604
LIM1_Testin_like 627..684 CDD:188726 18/56 (32%)
LIM2_Testin_like 691..748 CDD:188727 17/56 (30%)
LIM 755..810 CDD:295319 18/52 (35%)
pdlim7NP_957134.1 PDZ_signaling 3..81 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..232 8/62 (13%)
LIM1_Enigma 244..295 CDD:188836 18/56 (32%)
LIM2_Enigma 303..354 CDD:188840 16/53 (30%)
LIM3_Enigma 362..416 CDD:188842 18/52 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.