DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and Prickle4

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_001277266.1 Gene:Prickle4 / 381104 MGIID:2685785 Length:369 Species:Mus musculus


Alignment Length:292 Identity:88/292 - (30%)
Similarity:125/292 - (42%) Gaps:70/292 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   514 QVHDWLLDDDQLLDEIDKVFADMANGCKDISYPKPSLGELPTSQSSDSGFHSKPPTPGYGSEDLT 578
            |..||.|..|      :.:|.:          |.|     |....||||   :.|...|  ||.:
Mouse     4 QNSDWSLQQD------NPIFRE----------PDP-----PVYTDSDSG---RRPVEDY--EDTS 42

  Fly   579 AGQGRFASI-PGIEDMNMYPSCAG-------MP--------------EQFQQLRL----HGDEAS 617
            |.....:|: |...|:|...:..|       :|              |:..||||    ...::.
Mouse    43 AQAATCSSLGPPCLDINQVSNWPGFRTLLQQLPPQDSDERYCLALGEEELAQLRLFCAQRKQKSL 107

  Fly   618 GKNSTRTI-------LCADCNQPIAMGEVAVKADRAGKEIAWHPGCFKCITCRELLADLVYFFHQ 675
            |:...|.:       .|..|.:.:..||..|.|.|||::..||..||.|..|.:.|.:|:||:|:
Mouse   108 GQGVARLLPPKLEGYTCKKCKKLLDPGEYGVFAARAGEQSCWHRPCFACQACGQGLINLIYFYHE 172

  Fly   676 GQVFCGRDLAIRLKIPRCRACDELIFTKEYTAAEEATFHIKHFCCYQCDEPLAGQQYIADEKSNM 740
            |.::|||..|..|: |||.|||:|||::..|.||...:|..||||..|..||.|.:|.....|  
Mouse   173 GHLYCGRHHAELLR-PRCPACDQLIFSQRCTEAEGQRWHENHFCCQDCAGPLDGGRYALPGGS-- 234

  Fly   741 PLCLLCYDRLFAVRCQRCKVAIGPADQGVAWG 772
            |.|..|:.:.:.        :.|.:..|||.|
Mouse   235 PCCPSCFSKRYR--------SAGSSSVGVAEG 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604
LIM1_Testin_like 627..684 CDD:188726 24/56 (43%)
LIM2_Testin_like 691..748 CDD:188727 26/56 (46%)
LIM 755..810 CDD:295319 5/18 (28%)
Prickle4NP_001277266.1 PET_OEBT 1..116 CDD:193603 31/137 (23%)
LIM1_Testin_like 124..181 CDD:188726 24/56 (43%)
LIM2_Testin_like 187..241 CDD:188727 25/55 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.