DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and Wtip

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:XP_008757482.2 Gene:Wtip / 361552 RGDID:1306411 Length:397 Species:Rattus norvegicus


Alignment Length:291 Identity:70/291 - (24%)
Similarity:102/291 - (35%) Gaps:75/291 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   537 ANGCKDISYPKPSLGELPTSQSSDSGFHSKPPTPGYGSEDLTAGQGRFASIPGIEDMNMYPSCAG 601
            |..|.|:.  .|.:|..|......:.|    |.|             ..|:|      :.|...|
  Rat   121 AGACADLL--PPGVGPTPARSPEPAQF----PFP-------------LPSLP------LPPGREG 160

  Fly   602 MPEQFQQLRLHGDEASGKNSTRTI----------LCADCNQPI--------AMGEVAVKADRAGK 648
            .|...:: ||   ||..:...|.:          :|..|...|        |||.:         
  Rat   161 GPSAAER-RL---EALTRELERALEARTARDYFGICIKCGLGIYGARQACQAMGSL--------- 212

  Fly   649 EIAWHPGCFKCITCRELLADLVYFFHQGQVFCGRDL---AIRLKIPRCRACDELIFTKEYTAAEE 710
               :|..||.|.:|...|....::....:|:|..|.   ..:....:|..|..||......|..:
  Rat   213 ---YHTDCFICDSCGRRLRGKAFYNVGEKVYCQEDFLYSGFQQTADKCSVCGHLIMEMILQALGK 274

  Fly   711 ATFHIKHFCCYQCDEPLAGQQYIADEKSNMPLCLLCYDRLFAVRCQRCKVAIGPADQG------V 769
             ::|...|.|..|:|.|.|..:..|.::|: .|:..|..:||.:|..|...|.|| ||      |
  Rat   275 -SYHPGCFRCSVCNECLDGVPFTVDVENNI-YCVRDYHTVFAPKCASCARPILPA-QGCETTIRV 336

  Fly   770 AWGDVHWHASCFVCAGVQCSKPLIG--GRFC 798
            ...|..:|..|:.|.  .|...|.|  ||.|
  Rat   337 VSMDRDYHVECYHCE--DCGMQLSGEEGRRC 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604
LIM1_Testin_like 627..684 CDD:188726 14/64 (22%)
LIM2_Testin_like 691..748 CDD:188727 15/56 (27%)
LIM 755..810 CDD:295319 18/52 (35%)
WtipXP_008757482.2 PRK07003 <23..>185 CDD:235906 19/92 (21%)
LIM1_Ajuba_like 192..245 CDD:188738 14/64 (22%)
LIM2_Ajuba_like 257..309 CDD:188741 15/53 (28%)
LIM3_Ajuba_like 317..378 CDD:188822 18/52 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.