DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and ap

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_724428.1 Gene:ap / 35509 FlyBaseID:FBgn0267978 Length:469 Species:Drosophila melanogaster


Alignment Length:126 Identity:36/126 - (28%)
Similarity:49/126 - (38%) Gaps:15/126 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   614 DEASGKNSTRTI-LCADCNQPIAMGEVAVKADR---AGKEIAWHPGCFKCITCRE-LLADLVYFF 673
            :..|....||.: .|:.|.:.|        .||   :..|..||..|.:|..||: |..:...:.
  Fly   134 ESTSDSKITRNLDDCSGCGRQI--------QDRFYLSAVEKRWHASCLQCYACRQPLERESSCYS 190

  Fly   674 HQGQVFCGRDLAIRLKIPRCRACDELIFTKEYT-AAEEATFHIKHFCCYQCDEPLA-GQQY 732
            ..|.::|..|........||..|...|.:.|.. .|....||:..|||..|..||. |.||
  Fly   191 RDGNIYCKNDYYSFFGTRRCSRCLASISSNELVMRARNLVFHVNCFCCTVCHTPLTKGDQY 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604
LIM1_Testin_like 627..684 CDD:188726 15/60 (25%)
LIM2_Testin_like 691..748 CDD:188727 17/44 (39%)
LIM 755..810 CDD:295319
apNP_724428.1 LIM1_Lhx2_Lhx9 148..201 CDD:188755 15/60 (25%)
LIM2_Lhx2_Lhx9 206..264 CDD:188763 17/46 (37%)
Homeobox 371..424 CDD:395001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.