DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and CG31624

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster


Alignment Length:190 Identity:59/190 - (31%)
Similarity:81/190 - (42%) Gaps:16/190 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   622 TRTILCADCNQPIAMGEVAVKADRAGKEIAWHPGCFKCITCRELLADLVYFFHQGQVFCGRDLAI 686
            |.:|:|..|.:.|....:..    .||  .|||..|.|..|.|.:.|..:....|:..|.:....
  Fly     2 TESIVCHKCQEAITKRMITA----LGK--TWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVE 60

  Fly   687 RLKIPRCRACDELIFTKEYTAAEEATFHIKHFCC-YQCDEPLAGQQYIADEKSNMPLCLLCYDRL 750
            |... .|..|.:.|..|...|..| .:|...||| ..|.:|||.|.:.  |:...|.|...|:.|
  Fly    61 RYTY-TCAGCKKPILEKTICAMGE-RWHEACFCCGGACKKPLASQTFY--ERDGKPYCKQDYENL 121

  Fly   751 FAVRCQRCKVAIGPADQGVAWGDVHWHASCFVCAGVQCSKPLIGGRFCVKENMPFCSPTC 810
            ||.||.:|:..|  .|..|...:|.||.:||.|.  :|..|:....|.:..:.|.| |.|
  Fly   122 FAARCAKCEKPI--TDSAVLAMNVKWHRNCFQCN--KCENPITSQTFTIDGDKPVC-PAC 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604
LIM1_Testin_like 627..684 CDD:188726 15/56 (27%)
LIM2_Testin_like 691..748 CDD:188727 18/57 (32%)
LIM 755..810 CDD:295319 17/54 (31%)
CG31624NP_001163031.1 LIM 7..58 CDD:351770 15/56 (27%)
LIM 66..118 CDD:351770 18/54 (33%)
LIM 125..176 CDD:214528 18/55 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
21.910

Return to query results.
Submit another query.