DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and Pax

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_001033913.1 Gene:Pax / 35215 FlyBaseID:FBgn0041789 Length:581 Species:Drosophila melanogaster


Alignment Length:320 Identity:86/320 - (26%)
Similarity:126/320 - (39%) Gaps:68/320 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   511 PMKQVHDWLLDDDQLLDEIDKVFADMA--------NGCKDISYPKPSLGELPTSQSSDSGFHSKP 567
            |.:|||.  ....|...|:|.:.|.::        ||..:.|:|:.....:.....:|..     
  Fly   238 PGQQVHQ--AYTSQATKELDDLMASLSDFKVSNGTNGIGNGSHPQQHSSTVQHQTVTDYA----- 295

  Fly   568 PTPGYGS---------EDLT----AGQGRFASIPGIEDMNMYPSCAGMPEQFQQLRLHGDEASGK 619
             .|..||         |:.|    :.:.:..|:.|....||                   ...|.
  Fly   296 -RPNKGSQQAHLTQTIEETTIVEDSREDQLDSMLGNLQANM-------------------SRQGV 340

  Fly   620 NSTRTILCADCNQPIAMGEVAVKADRAGKEIAWHPGCFKCITCRELLADLVYFFHQGQVFCGRDL 684
            |:.:...|..|.:|| :|:|..   ..||  .|||..|.|..|.:.|....:|...|..:|..|.
  Fly   341 NTVQKGCCNACEKPI-VGQVIT---ALGK--TWHPEHFTCNHCSQELGTRNFFERDGFPYCEPDY 399

  Fly   685 AIRLKIPRCRACDELIFTKEYTAAEEATFHIKHFCCYQCDEPLAGQQYIAD---EKSNMPLCLLC 746
            . .|..|||..|:..|..|..||.:: |:|.:||.|.||     |||:..:   |:...|.|...
  Fly   400 H-NLFSPRCAYCNGAILDKCVTALDK-TWHTEHFFCAQC-----GQQFGEEGFHERDGKPYCRND 457

  Fly   747 YDRLFAVRCQRCKVAIGPADQGVAWGDVHWHASCFVCAGVQCSKPLIGGRFCVKENMPFC 806
            |..:||.:|..|..||  .:..::..:..||..||||.  .|.:|..||.|...|.:|:|
  Fly   458 YFEMFAPKCNGCNRAI--MENYISALNSQWHPDCFVCR--DCRQPFQGGSFFDHEGLPYC 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604
LIM1_Testin_like 627..684 CDD:188726 18/56 (32%)
LIM2_Testin_like 691..748 CDD:188727 21/59 (36%)
LIM 755..810 CDD:295319 18/52 (35%)
PaxNP_001033913.1 LIM1_Paxillin_like 348..400 CDD:259830 19/57 (33%)
LIM2_Paxillin_like 407..458 CDD:188723 19/56 (34%)
LIM3_Paxillin_like 466..518 CDD:188724 18/52 (35%)
LIM4_Paxillin 525..576 CDD:188795
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
21.910

Return to query results.
Submit another query.