DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and rga3

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_594871.1 Gene:rga3 / 2542306 PomBaseID:SPAC29A4.11 Length:969 Species:Schizosaccharomyces pombe


Alignment Length:172 Identity:40/172 - (23%)
Similarity:55/172 - (31%) Gaps:62/172 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   648 KEIAWHPG------CFKCITCRELLADLVYFFHQGQVFCGRDLAIRLKIPRCRACDELIFTKEYT 706
            |.|:..|.      ||:|                ||.|..|:..|                    
pombe     5 KSISKSPSSKGSTVCFRC----------------GQAFQRRETPI-------------------- 33

  Fly   707 AAEEATF--HIKH---FCCYQCDEPLA-GQQYIADEKSNMPLCLLCYDRLFAVRCQRCKVAIGPA 765
                 :|  |:.|   |||.:||:.|. ..|.:.......|:|..|     |..|..|::.|  .
pombe    34 -----SFGGHMWHKDCFCCTKCDKGLEHSDQMLVQTSDGRPVCSSC-----AHTCTACRMRI--K 86

  Fly   766 DQGVAWGDVHWHASCFVCAGVQCSKPLIGGRFCVKENMPFCS 807
            |..:..|...:|..||.|.  .|.|.:|...|.......||:
pombe    87 DYALMSGYDSYHRECFRCH--DCRKQIIDSNFKRDNRTIFCN 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604
LIM1_Testin_like 627..684 CDD:188726 10/41 (24%)
LIM2_Testin_like 691..748 CDD:188727 13/62 (21%)
LIM 755..810 CDD:295319 15/53 (28%)
rga3NP_594871.1 LIM 18..74 CDD:214528 20/96 (21%)
LIM 78..128 CDD:259829 15/53 (28%)
C1 698..743 CDD:237996
RhoGAP 791..962 CDD:214618
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.