DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and rga1

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_596743.1 Gene:rga1 / 2541022 PomBaseID:SPBC3F6.05 Length:1150 Species:Schizosaccharomyces pombe


Alignment Length:274 Identity:69/274 - (25%)
Similarity:95/274 - (34%) Gaps:72/274 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   546 PKPSLGELPTSQSSDSGF-HSKPPTPGYGSEDLTAGQGRFASIPGIEDMNMYPSCAGMPEQFQQL 609
            |.||........|:...| ||:..:...|:|..::...|..|.         .|...:|.| |||
pombe    27 PVPSRQNKIEENSTTKNFPHSRHTSTVAGTEGGSSLSRRHTSA---------ESRKALPNQ-QQL 81

  Fly   610 RLHG-----DEASGKNSTRTI------------LCADCNQPI------AMGEVAVKADRAGKEIA 651
            ...|     ::.|.|.|..::            :||.|.|.|      |:|.:            
pombe    82 AQSGLLNKEEQQSLKRSDTSVFPKAVRKVSSSKICASCGQVISGQYVRALGNI------------ 134

  Fly   652 WHPGCFKCITCRELLADLVYFF-------HQGQVFCGRDLAIRLKIPRCRACDELIFTKEYTAAE 709
            :|..||:|..|..|:|.  .||       ::....|..|...||.: .|.:|. :.....|..|.
pombe   135 YHLECFRCHDCNSLVAS--KFFPIDDPTLNKQVPLCETDYFRRLDL-LCASCG-MALRGYYITAL 195

  Fly   710 EATFHIKHFCCYQCDEPLAGQQYIADEKSNMPLCLLCYDRLFAVRCQRCKVAIGPA--------D 766
            ...|||:||.|..| ..:.|......|......|...|..|||.||..|.   ||.        .
pombe   196 NKKFHIEHFTCSLC-YTVFGPNDSYYEYEGKVYCHYHYSTLFAARCCGCD---GPILRQFVEVYR 256

  Fly   767 QGVAWGDVHWHASC 780
            .||:   .:||..|
pombe   257 NGVS---QNWHVPC 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604
LIM1_Testin_like 627..684 CDD:188726 17/69 (25%)
LIM2_Testin_like 691..748 CDD:188727 14/56 (25%)
LIM 755..810 CDD:295319 9/34 (26%)
rga1NP_596743.1 LIM1_Lrg1p_like 116..172 CDD:188777 17/69 (25%)
LIM2_Lrg1p_like 180..232 CDD:188778 14/53 (26%)
LIM 485..539 CDD:295319
RhoGAP_fLRG1 835..1044 CDD:239862
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.