Sequence 1: | NP_611215.1 | Gene: | Tes / 36965 | FlyBaseID: | FBgn0034223 | Length: | 816 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001287944.1 | Gene: | ABLIM3 / 22885 | HGNCID: | 29132 | Length: | 683 | Species: | Homo sapiens |
Alignment Length: | 237 | Identity: | 58/237 - (24%) |
---|---|---|---|
Similarity: | 83/237 - (35%) | Gaps: | 59/237 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 619 KNSTRTILCADCNQPIAMGEVAVKADRAGKEIAWHPGCFKCITCRELLADLVYFFHQGQVFCGRD 683
Fly 684 LAIRLKIPRCRACDELIFTKEYTAAEEATFHIKHFCCYQCDEPLAGQQYIADE---KSNMPLCLL 745
Fly 746 CYDRLFAVR---------CQRCKVAIGPADQGVAWGDVHWHASCFVCAGVQCSKPLIGGRFCVKE 801
Fly 802 NMPFCS-------------------------------PTCVR 812 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Tes | NP_611215.1 | PET_testin | 110..197 | CDD:193604 | |
LIM1_Testin_like | 627..684 | CDD:188726 | 15/56 (27%) | ||
LIM2_Testin_like | 691..748 | CDD:188727 | 18/59 (31%) | ||
LIM | 755..810 | CDD:295319 | 18/85 (21%) | ||
ABLIM3 | NP_001287944.1 | LIM1_abLIM | 23..74 | CDD:188713 | 15/56 (27%) |
LIM2_abLIM | 79..134 | CDD:188714 | 17/59 (29%) | ||
LIM3_abLIM | 151..202 | CDD:188715 | 17/54 (31%) | ||
LIM4_abLIM | 210..265 | CDD:188716 | 4/26 (15%) | ||
AbLIM_anchor | 274..647 | CDD:292800 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 372..472 | ||||
VHP | 648..683 | CDD:128458 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |