DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and FHL2

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_001034581.1 Gene:FHL2 / 2274 HGNCID:3703 Length:279 Species:Homo sapiens


Alignment Length:184 Identity:54/184 - (29%)
Similarity:86/184 - (46%) Gaps:18/184 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   627 CADCNQPIAMGEVAVKADRAGKEIAWHPGCFKCITCRELLADLVYFFHQGQVFCGRDLAIRLKIP 691
            |.:|.:||...    ..|.:.|:..||..||.|..||..|.|..:...:.|:.| .|........
Human    40 CEECGKPIGCD----CKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLC-TDCYSNEYSS 99

  Fly   692 RCRACDELIF----TKEYTAAEEATFHIKHFCCYQCDEPLAGQQYIADEKSNMPLCLLCYDRLFA 752
            :|:.|.:.|.    ..||   :.:::|...|.|::|.:|:..:.:|  .|.|...|:.||::..|
Human   100 KCQECKKTIMPGTRKMEY---KGSSWHETCFICHRCQQPIGTKSFI--PKDNQNFCVPCYEKQHA 159

  Fly   753 VRCQRCKVAIGPADQGVAWGDVHWHASCFVCAGVQCSKPLIGGRFCVKENMPFC 806
            ::|.:||..|  ...||.:.:..||..||||..  |.|.|.|.||..:::..:|
Human   160 MQCVQCKKPI--TTGGVTYREQPWHKECFVCTA--CRKQLSGQRFTARDDFAYC 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604
LIM1_Testin_like 627..684 CDD:188726 17/56 (30%)
LIM2_Testin_like 691..748 CDD:188727 15/60 (25%)
LIM 755..810 CDD:295319 19/52 (37%)
FHL2NP_001034581.1 LIM <5..33 CDD:413332
LIM1_FHL2 36..97 CDD:188806 18/61 (30%)
LIM2_FHL2 101..157 CDD:188810 16/60 (27%)
LIM3_Fhl2 162..218 CDD:188815 19/52 (37%)
LIM4_FHL2 221..278 CDD:188817
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.