DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and ceh-14

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_509273.1 Gene:ceh-14 / 181012 WormBaseID:WBGene00000438 Length:351 Species:Caenorhabditis elegans


Alignment Length:149 Identity:33/149 - (22%)
Similarity:62/149 - (41%) Gaps:22/149 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   617 SGKNSTRTILCADCNQPIAMGEVAVKADRAGKEI---AWHPGCFKCITCRELLADLVYFFHQGQV 678
            :|..:....:|:.|::.|        .||...::   .:|..|.:|.||::.|. ...|..:..:
 Worm    38 AGHPNNEEAICSLCDKKI--------RDRFVSKVNGRCYHSSCLRCSTCKDELG-ATCFLREDSM 93

  Fly   679 FCGRDLAIRLKIPRCRACDELIFTKEYT-AAEEATFHIKHFCCYQCDEPL-AGQQY--IADEKSN 739
            :|......:.. .:|.:|:|.|...... .|....:|::.|.|:.|...| .|:::  |||:.. 
 Worm    94 YCRAHFYKKFG-TKCSSCNEGIVPDHVVRKASNHVYHVECFQCFICKRSLETGEEFYLIADDAR- 156

  Fly   740 MPLCLLCYDRLFAVRCQRC 758
                |:|.|.....|.:.|
 Worm   157 ----LVCKDDYEQARDKHC 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604
LIM1_Testin_like 627..684 CDD:188726 13/59 (22%)
LIM2_Testin_like 691..748 CDD:188727 16/60 (27%)
LIM 755..810 CDD:295319 1/4 (25%)
ceh-14NP_509273.1 LIM 48..103 CDD:278823 13/63 (21%)
LIM2_Lhx3_Lhx4 107..163 CDD:188762 17/60 (28%)
COG5576 <172..295 CDD:227863 33/149 (22%)
Homeobox 183..236 CDD:278475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.