DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and lim-4

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_508669.1 Gene:lim-4 / 180672 WormBaseID:WBGene00002987 Length:355 Species:Caenorhabditis elegans


Alignment Length:265 Identity:59/265 - (22%)
Similarity:93/265 - (35%) Gaps:75/265 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   507 HLLQPMKQVHDWLLDDDQL--------LDEIDKVFADMANGCKDISYPKPSLGELPTSQSSDSGF 563
            ||:|..|......|.|..|        |.......:|..:.|.:::..    |.:|.:|.    |
 Worm     4 HLVQAKKTSTASELSDSSLTFPFIGDYLSSPSLTTSDYVSDCSNLTVE----GPVPANQE----F 60

  Fly   564 HSKPPTPGYGSEDLTAGQGRFASIPGIEDMNMYPSCAGMPEQFQQLRLHGDEASGKNSTRTILCA 628
            .|...:..|.|..|     |.|......|.|              :|:..|..       .::|.
 Worm    61 SSSDESSVYISSAL-----RLADYAFTPDDN--------------IRIKPDAV-------IVICT 99

  Fly   629 DCNQPIAMGEVAVKADRAGKEIAWHPGCFKCITCRELLADLVY-----FFHQGQVF--------- 679
            .|...| ..:..:..|  |:.  :|..|.:|.||...|::..:     |:.:|..|         
 Worm   100 QCQHQI-QDKFFLSID--GRN--YHENCLQCSTCENPLSNKCFYKDKTFYCKGCYFRTHVTSTAS 159

  Fly   680 -CGRDLAIRLKIPRCRACDELIFTKEYT-AAEEATFHIKHFCCYQCDEPLA-GQQYIADEKSNMP 741
             | |:|.     |:|.:||..|...::. .|....:|:..|.|.||...|: |::|...|.:   
 Worm   160 SC-RELG-----PKCASCDRTIQATDWVRRARNYVYHLACFSCNQCKRQLSTGEEYALQEGN--- 215

  Fly   742 LCLLC 746
              |||
 Worm   216 --LLC 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604
LIM1_Testin_like 627..684 CDD:188726 16/71 (23%)
LIM2_Testin_like 691..748 CDD:188727 18/58 (31%)
LIM 755..810 CDD:295319
lim-4NP_508669.1 LIM 98..153 CDD:278823 14/59 (24%)
LIM2_AWH 168..222 CDD:188765 17/56 (30%)
HOX 239..295 CDD:197696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.