DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and Fhl4

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_034344.2 Gene:Fhl4 / 14202 MGIID:1338765 Length:279 Species:Mus musculus


Alignment Length:194 Identity:61/194 - (31%)
Similarity:92/194 - (47%) Gaps:19/194 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   626 LCADCNQPIAMGEVAVKADRAGKEIAWHPGCFKCITCRELLADLVYFFHQGQVFCGRDLAIRLKI 690
            :|.:|::||.    |...:...||..||..||||..|.:|||...:......:.|.: .|.|:..
Mouse    38 ICQECHKPIG----ADSKEVCYKEQFWHNTCFKCSKCSQLLATETFVAWDKNILCNK-CATRVTF 97

  Fly   691 PRCRAC----DELIFTKEYTAAEEATFHIKHFCCYQCDEPLAGQQYIADEKSNMPLCLLCYDRLF 751
            |:|:.|    :|.....||   :.:.:|...|.|..|.:.:..:.:...::..  .|:.|||.||
Mouse    98 PKCKGCLKDIEEGDHNVEY---KGSIWHKNCFVCTNCKDIIGTKNFFPKDEGF--YCVTCYDALF 157

  Fly   752 AVRCQRCKVAIGPADQGVAWGDVHWHASCFVCAGVQCSKPLIGGRFCVKENMPFCSPTCVRSLI 815
            ...|.:||..|  ...||::.|..||:.||||  |.|||.|.|.||...::..|| ..|.::.|
Mouse   158 TKHCMKCKKPI--TSGGVSYQDQPWHSECFVC--VSCSKELSGQRFTAMDDQYFC-VDCYKNYI 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604
LIM1_Testin_like 627..684 CDD:188726 18/56 (32%)
LIM2_Testin_like 691..748 CDD:188727 12/60 (20%)
LIM 755..810 CDD:295319 23/54 (43%)
Fhl4NP_034344.2 LIM <4..32 CDD:295319
LIM 39..92 CDD:295319 18/57 (32%)
LIM2_FHL1 100..157 CDD:188808 13/61 (21%)
LIM3_FHL1 161..213 CDD:188813 24/56 (43%)
LIM4_FHL1 216..279 CDD:188734 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.