DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and Fhl1

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:XP_006527864.1 Gene:Fhl1 / 14199 MGIID:1298387 Length:339 Species:Mus musculus


Alignment Length:195 Identity:60/195 - (30%)
Similarity:87/195 - (44%) Gaps:23/195 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   627 CADCNQPIAMGEVAVKADRAGKEI-----AWHPGCFKCITCRELLADLVYFFHQGQVFCGRDLAI 686
            |.||.:||:       ||  .||:     .||..||:|..|...||...:....|::.|.: .|.
Mouse    56 CVDCRKPIS-------AD--AKEVHYKNRYWHDNCFRCAKCLHPLASETFVSKDGKILCNK-CAT 110

  Fly   687 RLKIPRCRACDELIFTKEYTAAEEAT-FHIKHFCCYQCDEPLAGQQYIADEKSNMPLCLLCYDRL 750
            |...|||:.|.:.|...:.....:.| :|...|.|..|.:.:....:.  .|.....|:.|::..
Mouse   111 REDSPRCKGCFKAIVAGDQNVEYKGTVWHKDCFTCSNCKQVIGTGSFF--PKGEDFYCVTCHETK 173

  Fly   751 FAVRCQRCKVAIGPADQGVAWGDVHWHASCFVCAGVQCSKPLIGGRFCVKENMPFCSPTCVRSLI 815
            ||..|.:|..||  ...|:.:.|..|||.||||  |.|||.|.|.||...|:..:| ..|.::.:
Mouse   174 FAKHCVKCNKAI--TSGGITYQDQPWHAECFVC--VTCSKKLAGQRFTAVEDQYYC-VDCYKNFV 233

  Fly   816  815
            Mouse   234  233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604
LIM1_Testin_like 627..684 CDD:188726 19/61 (31%)
LIM2_Testin_like 691..748 CDD:188727 13/57 (23%)
LIM 755..810 CDD:295319 23/54 (43%)
Fhl1XP_006527864.1 LIM <21..49 CDD:351770
LIM1_FHL1 56..109 CDD:188730 19/62 (31%)
LIM2_FHL1 117..174 CDD:188808 11/58 (19%)
LIM3_FHL1 178..230 CDD:188813 24/56 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.