Sequence 1: | NP_611215.1 | Gene: | Tes / 36965 | FlyBaseID: | FBgn0034223 | Length: | 816 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006527864.1 | Gene: | Fhl1 / 14199 | MGIID: | 1298387 | Length: | 339 | Species: | Mus musculus |
Alignment Length: | 195 | Identity: | 60/195 - (30%) |
---|---|---|---|
Similarity: | 87/195 - (44%) | Gaps: | 23/195 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 627 CADCNQPIAMGEVAVKADRAGKEI-----AWHPGCFKCITCRELLADLVYFFHQGQVFCGRDLAI 686
Fly 687 RLKIPRCRACDELIFTKEYTAAEEAT-FHIKHFCCYQCDEPLAGQQYIADEKSNMPLCLLCYDRL 750
Fly 751 FAVRCQRCKVAIGPADQGVAWGDVHWHASCFVCAGVQCSKPLIGGRFCVKENMPFCSPTCVRSLI 815
Fly 816 815 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Tes | NP_611215.1 | PET_testin | 110..197 | CDD:193604 | |
LIM1_Testin_like | 627..684 | CDD:188726 | 19/61 (31%) | ||
LIM2_Testin_like | 691..748 | CDD:188727 | 13/57 (23%) | ||
LIM | 755..810 | CDD:295319 | 23/54 (43%) | ||
Fhl1 | XP_006527864.1 | LIM | <21..49 | CDD:351770 | |
LIM1_FHL1 | 56..109 | CDD:188730 | 19/62 (31%) | ||
LIM2_FHL1 | 117..174 | CDD:188808 | 11/58 (19%) | ||
LIM3_FHL1 | 178..230 | CDD:188813 | 24/56 (43%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1704 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X39 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |