DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and Csrp3

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_001185770.1 Gene:Csrp3 / 13009 MGIID:1330824 Length:194 Species:Mus musculus


Alignment Length:165 Identity:33/165 - (20%)
Similarity:51/165 - (30%) Gaps:55/165 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   692 RCRACDELIFTKEYTAAEEATFHIKHFCCYQCDEPLAGQQYIADEKSNMPLCLLCYDRLF----- 751
            :|.||::.::..|.......:||...|.|..|.:.|......|.|..  ..|.:||.|.:     
Mouse     9 KCGACEKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESE--IYCKVCYGRRYGPKGI 71

  Fly   752 ---------------------------------------------AVRCQRCKVAIGPADQGVAW 771
                                                         :.:|.||..::..|:: |..
Mouse    72 GFGQGAGCLSTDTGEHLGLQFQQSPKPARAATTSNPSKFSAKFGESEKCPRCGKSVYAAEK-VMG 135

  Fly   772 GDVHWHASCFVCAGVQCSKPLIGGRFCVKENMPFC 806
            |...||.:||.||  .|.|.|.......|:...:|
Mouse   136 GGKPWHKTCFRCA--ICGKSLESTNVTDKDGELYC 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604
LIM1_Testin_like 627..684 CDD:188726
LIM2_Testin_like 691..748 CDD:188727 14/55 (25%)
LIM 755..810 CDD:295319 17/52 (33%)
Csrp3NP_001185770.1 Interaction with TCAP. /evidence=ECO:0000250|UniProtKB:P50461 1..5
LIM1_CRP3 9..62 CDD:188865 13/54 (24%)
Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:P50463, ECO:0000255 64..69 1/4 (25%)
Interaction with CLF2. /evidence=ECO:0000250|UniProtKB:P50461 94..105 0/10 (0%)
LIM2_CRP3 120..173 CDD:188866 17/52 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.