DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and AgaP_AGAP009503

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:XP_310193.4 Gene:AgaP_AGAP009503 / 1271408 VectorBaseID:AGAP009503 Length:499 Species:Anopheles gambiae


Alignment Length:279 Identity:66/279 - (23%)
Similarity:107/279 - (38%) Gaps:36/279 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   544 SYPKPSLGELPTSQSSDSGFHSKPPTPGYGSEDLTAGQGRFASIPGIEDMNMYPSCAGMPEQFQQ 608
            :|...|.|. .|.:|.....:.:||:...|..:.:. ...:.:..||...|.....:...:|.||
Mosquito   205 TYGMSSQGS-TTYESIYEPINPRPPSQMSGRSNYSL-YAPYVNSHGINSPNDSIITSASQQQQQQ 267

  Fly   609 LRLHGDEASGKNS---TRTIL-------------CADCNQPIAMGEVAVKADRAGKEIAWHPGCF 657
            ...|...:..|.:   |.|.|             |..|.:.: :||   |......:..:|..||
Mosquito   268 QHRHNQGSMSKGAEVDTLTDLLVQSIHDQESFGTCVKCGERV-VGE---KTGCTAMDKIYHIACF 328

  Fly   658 KCITCRELLADLVYFFHQGQVFCGRDLAIRLKIPRCRACDELIFTKEYTAAEEATFHIKHFCCYQ 722
            .|..|:..|....::...|:.:|..|....|:  :|..|.:.|..:...|..: .:|.:.|.|..
Mosquito   329 TCHQCQINLQGKPFYGLDGKPYCKEDYLNTLE--KCSVCLKPILERILRATGK-PYHPQCFTCIV 390

  Fly   723 CDEPLAGQQYIADEKSNMPLCLLCYDRLFAVRCQRCKVAI--GPADQ---GVAWGDVHWHASCFV 782
            |.:.|.|..:..| .:|...|:..:.:.||.||..||:.|  ||.:.   .|...|..:|.:|:.
Mosquito   391 CGKSLDGIPFTVD-ATNQIHCIDDFHKKFAPRCCVCKMPIMPGPGEDETVRVVALDRSFHINCYK 454

  Fly   783 CAGVQCSKPLIG---GRFC 798
            |.  .|...|..   ||.|
Mosquito   455 CE--DCGLVLSSEAEGRGC 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604
LIM1_Testin_like 627..684 CDD:188726 13/56 (23%)
LIM2_Testin_like 691..748 CDD:188727 13/56 (23%)
LIM 755..810 CDD:295319 16/52 (31%)
AgaP_AGAP009503XP_310193.4 LIM1_LPP 302..355 CDD:188737 13/56 (23%)
LIM2_LPP 362..421 CDD:188740 15/60 (25%)
LIM3_LPP 422..489 CDD:188821 16/52 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.