Sequence 1: | NP_611215.1 | Gene: | Tes / 36965 | FlyBaseID: | FBgn0034223 | Length: | 816 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_308221.4 | Gene: | PRIC1_ANOGA / 1269578 | VectorBaseID: | AGAP007648 | Length: | 923 | Species: | Anopheles gambiae |
Alignment Length: | 263 | Identity: | 97/263 - (36%) |
---|---|---|---|
Similarity: | 132/263 - (50%) | Gaps: | 44/263 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 584 FASIPGIEDMNMYPSCAG----MPEQFQQLRLHGD-------------------------EASG- 618
Fly 619 ---KNSTRTILCADCNQPIAMGEVAVKADRAGKEIAWHPGCFKCITCRELLADLVYFFHQGQVFC 680
Fly 681 GRDLAIRLKIPRCRACDELIFTKEYTAAEEATFHIKHFCCYQCDEPLAGQQYIADEKSNMPLCLL 745
Fly 746 CYDRLFAVRCQRCKVAIGPADQG-VAWGDVHWHAS--CFVCAGVQCSKPLIGGRFCVKENMPFCS 807
Fly 808 PTC 810 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Tes | NP_611215.1 | PET_testin | 110..197 | CDD:193604 | |
LIM1_Testin_like | 627..684 | CDD:188726 | 23/56 (41%) | ||
LIM2_Testin_like | 691..748 | CDD:188727 | 29/56 (52%) | ||
LIM | 755..810 | CDD:295319 | 21/57 (37%) | ||
PRIC1_ANOGA | XP_308221.4 | PET_Prickle | 283..378 | CDD:193602 | 15/69 (22%) |
LIM1_Prickle | 384..442 | CDD:188799 | 23/57 (40%) | ||
LIM2_Prickle | 447..502 | CDD:188802 | 29/56 (52%) | ||
LIM3_Prickle | 507..565 | CDD:188804 | 22/61 (36%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1704 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 1 | 1.000 | - | - | X39 | |
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |