DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and WTIP

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:XP_011524754.1 Gene:WTIP / 126374 HGNCID:20964 Length:472 Species:Homo sapiens


Alignment Length:309 Identity:76/309 - (24%)
Similarity:117/309 - (37%) Gaps:65/309 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   548 PSLGELPTSQSS-----DSGFHSK--PP--TPGYGSEDLTAGQGRFASIPGIEDMNMYPSCAGMP 603
            ||:|...:|.||     .:|.::.  ||  .|........||...| .:|.:.   :.|...|.|
Human   135 PSVGSARSSVSSLGSRGSAGAYADFLPPGACPAPARSPEPAGPAPF-PLPALP---LPPGREGGP 195

  Fly   604 EQFQQLRLHGDEASGKNSTRTI----------LCADCNQPI--------AMGEVAVKADRAGKEI 650
            ...:: ||   ||..:...|.:          :|..|...|        |||.:           
Human   196 SAAER-RL---EALTRELERALEARTARDYFGICIKCGLGIYGAQQACQAMGSL----------- 245

  Fly   651 AWHPGCFKCITCRELLADLVYFFHQGQVFCGRDL---AIRLKIPRCRACDELIFTKEYTAAEEAT 712
             :|..||.|.:|...|....::....:|:|..|.   ..:....:|..|..||......|..: :
Human   246 -YHTDCFTCDSCGRRLRGKAFYNVGEKVYCQEDFLYSGFQQTADKCSVCGHLIMEMILQALGK-S 308

  Fly   713 FHIKHFCCYQCDEPLAGQQYIADEKSNMPLCLLCYDRLFAVRCQRCKVAIGPADQG------VAW 771
            :|...|.|..|:|.|.|..:..|.::|: .|:..|..:||.:|..|...|.|| ||      |..
Human   309 YHPGCFRCSVCNECLDGVPFTVDVENNI-YCVRDYHTVFAPKCASCARPILPA-QGCETTIRVVS 371

  Fly   772 GDVHWHASCFVC------AGVQCSKPLIGGRFCVKENMPFCSPTCVRSL 814
            .|..:|.:|:.|      |.:..|.||.....|:::....|..:||..|
Human   372 MDRDYHVACYHCEDPGDEARMADSNPLAASLPCMEQLSLGCRSSCVPPL 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604
LIM1_Testin_like 627..684 CDD:188726 14/64 (22%)
LIM2_Testin_like 691..748 CDD:188727 15/56 (27%)
LIM 755..810 CDD:295319 18/66 (27%)
WTIPXP_011524754.1 LIM1_Ajuba_like 225..278 CDD:188738 14/64 (22%)
LIM2_Ajuba_like 290..342 CDD:188741 15/53 (28%)
LIM 350..404 CDD:295319 16/54 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.