DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and Lmx1a

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_387501.1 Gene:Lmx1a / 110648 MGIID:1888519 Length:382 Species:Mus musculus


Alignment Length:121 Identity:36/121 - (29%)
Similarity:51/121 - (42%) Gaps:18/121 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   693 CRACDELIFTKEYTAAEEATFHIKHFCCYQCDEPLAGQQYIADEKSNMPLCLLCYDRLFAVRCQR 757
            |..|..:|..:......::.:|.:...|..|.|||....:..|:|.   .|...|::||||:|..
Mouse    35 CEGCQRVISDRFLLRLNDSFWHEQCVQCASCKEPLETTCFYRDKKL---YCKYHYEKLFAVKCGG 96

  Fly   758 CKVAIGP------ADQGVAWGDVHWHASCFVCAGVQCSKPL-IGGRFCVKENMPFC 806
            |..||.|      |.:.|      :|.|||.|.  .|.:.| .|..|.:||....|
Mouse    97 CFEAIAPNEFVMRAQKSV------YHLSCFCCC--VCERQLQKGDEFVLKEGQLLC 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604
LIM1_Testin_like 627..684 CDD:188726
LIM2_Testin_like 691..748 CDD:188727 12/54 (22%)
LIM 755..810 CDD:295319 19/59 (32%)
Lmx1aNP_387501.1 LIM1_Lmx1a 35..86 CDD:188756 12/53 (23%)
LIM2_Lmx1a_Lmx1b 94..148 CDD:188764 19/59 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..208
Homeobox 198..252 CDD:365835
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 252..286
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.