DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and LOC110438489

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:XP_021326686.1 Gene:LOC110438489 / 110438489 -ID:- Length:194 Species:Danio rerio


Alignment Length:126 Identity:48/126 - (38%)
Similarity:65/126 - (51%) Gaps:28/126 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   604 EQFQQLRLHGD----EASGKNSTRTI-------LCADCNQPIAMGEVAVKADRAGKEIAWHPGCF 657
            |:.::|:|..:    |..|:.:.|..       :|..|...|..|::||.|.|||..:.|||.||
Zfish    74 EEKRELKLFSNQRKRENLGRGNVRPFPVTMTGAICEQCGGQINGGDIAVFASRAGHGVCWHPQCF 138

  Fly   658 KCITCRELLADLVYFFHQGQVFCGRDLAIRLKIPRCRACDELIFTKEYTAAEEATFHIKHF 718
            .|..|.|||.||:||:..|::||||..|.||| |||.||||                ::||
Zfish   139 VCSMCDELLVDLIYFYQDGKIFCGRHHAERLK-PRCSACDE----------------VRHF 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604
LIM1_Testin_like 627..684 CDD:188726 29/56 (52%)
LIM2_Testin_like 691..748 CDD:188727 9/28 (32%)
LIM 755..810 CDD:295319
LOC110438489XP_021326686.1 PET_Prickle <27..100 CDD:193602 6/25 (24%)
LIM1_Prickle 108..166 CDD:188799 29/57 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422310at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.