DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and crybb2

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_001238879.2 Gene:crybb2 / 100493744 XenbaseID:XB-GENE-5866500 Length:204 Species:Xenopus tropicalis


Alignment Length:56 Identity:14/56 - (25%)
Similarity:22/56 - (39%) Gaps:8/56 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 QLELQVPPHDLDAALCDGLTET-------EAIQLQQYVQKLREQCVGQGVVVRLGD 198
            |...|...|:|:.| |..|.||       ..:....:|...::.|.|:..|...|:
 Frog    23 QENFQGRSHELNGA-CSSLKETGMEKVGSVLVHSGPWVGYDQQNCKGEQFVFEKGE 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604 13/53 (25%)
LIM1_Testin_like 627..684 CDD:188726
LIM2_Testin_like 691..748 CDD:188727
LIM 755..810 CDD:295319
crybb2NP_001238879.2 XTALbg 17..99 CDD:214583 14/56 (25%)
Crystall 107..189 CDD:394987
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.