DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and LIMS4

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_001358269.1 Gene:LIMS4 / 100288695 HGNCID:39941 Length:398 Species:Homo sapiens


Alignment Length:248 Identity:69/248 - (27%)
Similarity:105/248 - (42%) Gaps:43/248 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   581 QGRFASIPGIEDMN--MYPS----CAGMPEQFQQLRLHGDEASGK----NSTRTILCADCNQPIA 635
            :|.||....|.:.|  :|..    ||...:||.:...:  |..|:    :..:.:....|:|   
Human    76 KGGFAPAETIVNSNGELYHEQCFVCAQCFQQFPEGLFY--EFEGRKYCEHDFQMLFAPCCHQ--- 135

  Fly   636 MGEVAVKADRAGKEIAWHPGCFKCITCRELLADLVYFFHQGQVFC----GRDLAIRLKIPRCRAC 696
            .||..:.........:|||.||:|..|:|:|||:.:..:.|:..|    .|:.|..|....|:.|
Human   136 CGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKARGLGKYICQKC 200

  Fly   697 ----DE--LIFTKEYTAAEEATFHIKHFCCYQCDEPLAGQQYIADEKSNMPLCLLCYDRLFAVRC 755
                ||  |||..:       .:|..||.|..|.:.|...   |.|......||.|:|::....|
Human   201 HAIIDEQPLIFKND-------PYHPDHFNCANCGKDLTAD---AQELKGELYCLPCHDKMGVPIC 255

  Fly   756 QRCKVAIGPADQGV--AWGDVHWHASCFVCAGVQCSKPLIGGRFCVKENMPFC 806
            ..|:   .|.:..|  |.|. .||...||||  :|.||.:|.|...::.:.:|
Human   256 GACR---RPIEGRVVNAMGK-QWHVEHFVCA--KCEKPFLGHRHYERKGLAYC 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604
LIM1_Testin_like 627..684 CDD:188726 18/60 (30%)
LIM2_Testin_like 691..748 CDD:188727 18/62 (29%)
LIM 755..810 CDD:295319 18/54 (33%)
LIMS4NP_001358269.1 LIM1_PINCH 72..130 CDD:188717 12/55 (22%)
LIM2_PINCH 133..184 CDD:188718 17/53 (32%)
LIM3_PINCH 197..247 CDD:188719 17/59 (29%)
LIM4_PINCH 253..306 CDD:188720 18/56 (32%)
LIM5_PINCH 314..367 CDD:188721
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.