DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and lims1

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:XP_012812021.1 Gene:lims1 / 100216119 XenbaseID:XB-GENE-967923 Length:397 Species:Xenopus tropicalis


Alignment Length:194 Identity:60/194 - (30%)
Similarity:89/194 - (45%) Gaps:38/194 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   627 CADCNQPIAMGEVAVKADRAGKEIAWHPGCFKCITCRELLADLVYFFHQGQVFC----GRDLAIR 687
            |..|.:.| :|.| :||    ...:|||.||:|..|:::|||:.:..:.|:..|    .|:.|..
 Frog   134 CHQCGEFI-IGRV-IKA----MNNSWHPECFRCDICQQVLADIGFVKNAGRHLCRPCHNREKARG 192

  Fly   688 LKIPRCRAC----DE--LIFTKEYTAAEEATFHIKHFCCYQCDEPLAGQQYIAD--EKSNMPLCL 744
            |....|:.|    ||  |||..:       .:|..||.|..|     |::..||  |......||
 Frog   193 LGKYICQKCHAIIDEQPLIFKND-------PYHPDHFNCANC-----GKELTADARELKGELYCL 245

  Fly   745 LCYDRLFAVRCQRCKVAIGPADQGV--AWGDVHWHASCFVCAGVQCSKPLIGGRFCVKENMPFC 806
            .|:|::....|..|:   .|.:..|  |.|. .||...||||  :|.||.:|.|...::.:.:|
 Frog   246 PCHDKMGVPICGACR---RPIEGRVVNAMGK-QWHVEHFVCA--KCEKPFLGHRHYERKGLAYC 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604
LIM1_Testin_like 627..684 CDD:188726 20/60 (33%)
LIM2_Testin_like 691..748 CDD:188727 19/64 (30%)
LIM 755..810 CDD:295319 18/54 (33%)
lims1XP_012812021.1 LIM1_PINCH 73..131 CDD:188717
LIM2_PINCH 134..185 CDD:188718 19/56 (34%)
LIM3_PINCH 198..248 CDD:188719 18/61 (30%)
LIM4_PINCH 254..307 CDD:188720 18/56 (32%)
LIM5_PINCH 315..368 CDD:188721
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.