DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tes and DUXB

DIOPT Version :9

Sequence 1:NP_611215.1 Gene:Tes / 36965 FlyBaseID:FBgn0034223 Length:816 Species:Drosophila melanogaster
Sequence 2:NP_001338236.1 Gene:DUXB / 100033411 HGNCID:33345 Length:345 Species:Homo sapiens


Alignment Length:415 Identity:72/415 - (17%)
Similarity:121/415 - (29%) Gaps:150/415 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 DAALKRKMQLELQVPPHDLDAALCDGLTETEAIQLQQYVQKLREQCVGQGVVVRLGDRLNHAQVE 206
            |.|.:.::..|:.||..::.....:...:...:..:.:.:|.:.|              .|.|.:
Human    41 DKAAREQLAKEIGVPESNIQVWFKNYRVKQRKLDYKCFSEKDQTQ--------------GHDQSQ 91

  Fly   207 HVAPALMPTQEAQQ-----TWQSLGLMPVADDTLNELLANPKVAQALASPASAHPKLLVAFSEPL 266
            |:....:| :||:|     ||..                ..::.||                   
Human    92 HLTQEYLP-KEARQKQTFITWTQ----------------KNRLVQA------------------- 120

  Fly   267 CESTAQFEENGALRAQTREKLLGISKPALLSLVTHGIVYDKVLGILQEKKLNISRDPKLGPIAEF 331
                  ||.|......||:||...:          |:...::....|:::....:..::.|:   
Human   121 ------FERNPFPDIATRKKLAEQT----------GLQESRIQMWFQKQRSLYLKKSRMEPM--- 166

  Fly   332 RKEYVNNPQFRAE-------INTICPQ------------------PPMTPIKSPPGTPFNSPLPL 371
             ...|::|..|.:       ||...|.                  ||:.|....|..||.     
Human   167 -NLLVDDPNERPDATVGWHPINLFLPTDSSHYFSCSHSSSGHETLPPVLPSTQAPWDPFR----- 225

  Fly   372 KNPVQIRMGAQMRQDTPMRRVKFGGVS---TIV--YDCGLPANT-DYDRDPVFAQILQAEPLKHA 430
               ..:..|..:....|.:.|:.|..|   .|:  :...||..| |.|....|....|.|   |.
Human   226 ---FHVSQGPNVMIMQPTQAVQEGEKSDQPLIIPNHLLTLPILTKDLDTPTPFWLQYQEE---HQ 284

  Fly   431 FQEARAGRAPSSVVISNIPAPVASLAELRGLNPATRAQLQSVGLDKNMLQSAVSNAPYYDRLFRS 495
            ..:..:|.....|...:.|.|     |.|...|....|...    .|:||.       :|.:   
Human   285 NHKEHSGSGVPQVKSHSQPEP-----EHREQQPLNLGQFDI----SNILQR-------WDEI--- 330

  Fly   496 LHDKGISHDQCHLL----QPMKQVH 516
                      |..|    .|:|..|
Human   331 ----------CQALLAEWDPLKGTH 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TesNP_611215.1 PET_testin 110..197 CDD:193604 7/54 (13%)
LIM1_Testin_like 627..684 CDD:188726
LIM2_Testin_like 691..748 CDD:188727
LIM 755..810 CDD:295319
DUXBNP_001338236.1 homeodomain 16..72 CDD:238039 5/30 (17%)
homeodomain 103..161 CDD:238039 14/108 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..314 9/39 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.