DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl and DYNLRB1

DIOPT Version :9

Sequence 1:NP_523771.1 Gene:robl / 36963 FlyBaseID:FBgn0024196 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001306086.1 Gene:DYNLRB1 / 83658 HGNCID:15468 Length:121 Species:Homo sapiens


Alignment Length:82 Identity:60/82 - (73%)
Similarity:67/82 - (81%) Gaps:0/82 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EVEETLKRIQSHKGVVGTIVVNNEGIPVKSTLDNTTTVQYAGLMSQLADKARSVVRDLDPSNDMT 68
            ||||||||:||.|||.|.||||.||||:|||:||.||.|||.||.....||||.|||:||.||:|
Human     3 EVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLT 67

  Fly    69 FLRVRSKKHEIMVAPDK 85
            |||:||||:||||||.|
Human    68 FLRIRSKKNEIMVAPGK 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roblNP_523771.1 Robl_LC7 4..94 CDD:397386 60/82 (73%)
DYNLRB1NP_001306086.1 Robl_LC7 4..87 CDD:214939 59/81 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143380
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4115
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53580
OrthoDB 1 1.010 - - D1512428at2759
OrthoFinder 1 1.000 - - FOG0003157
OrthoInspector 1 1.000 - - otm41896
orthoMCL 1 0.900 - - OOG6_101498
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3930
SonicParanoid 1 1.000 - - X2120
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.650

Return to query results.
Submit another query.