DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl and DYNLRB2

DIOPT Version :9

Sequence 1:NP_523771.1 Gene:robl / 36963 FlyBaseID:FBgn0024196 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001291946.1 Gene:DYNLRB2 / 83657 HGNCID:15467 Length:125 Species:Homo sapiens


Alignment Length:94 Identity:71/94 - (75%)
Similarity:86/94 - (91%) Gaps:0/94 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EVEETLKRIQSHKGVVGTIVVNNEGIPVKSTLDNTTTVQYAGLMSQLADKARSVVRDLDPSNDMT 68
            |||||||||||||||:||:|||.||||:::||||:||||||||:..|..||:|.|||:||.||:|
Human    32 EVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHHLTMKAKSTVRDIDPQNDLT 96

  Fly    69 FLRVRSKKHEIMVAPDKDFILIVIQNPTD 97
            |||:|||||||||||||:::|||||||.:
Human    97 FLRIRSKKHEIMVAPDKEYLLIVIQNPCE 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roblNP_523771.1 Robl_LC7 4..94 CDD:397386 68/89 (76%)
DYNLRB2NP_001291946.1 Robl_LC7 34..122 CDD:308728 66/87 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143379
Domainoid 1 1.000 145 1.000 Domainoid score I4603
eggNOG 1 0.900 - - E1_KOG4115
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12601
Inparanoid 1 1.050 153 1.000 Inparanoid score I4356
Isobase 1 0.950 - 0 Normalized mean entropy S2020
OMA 1 1.010 - - QHG53580
OrthoDB 1 1.010 - - D1512428at2759
OrthoFinder 1 1.000 - - FOG0003157
OrthoInspector 1 1.000 - - otm41896
orthoMCL 1 0.900 - - OOG6_101498
Panther 1 1.100 - - LDO PTHR10779
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3930
SonicParanoid 1 1.000 - - X2120
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.