DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl and Dynlrb1

DIOPT Version :9

Sequence 1:NP_523771.1 Gene:robl / 36963 FlyBaseID:FBgn0024196 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001278037.1 Gene:Dynlrb1 / 67068 MGIID:1914318 Length:104 Species:Mus musculus


Alignment Length:94 Identity:69/94 - (73%)
Similarity:79/94 - (84%) Gaps:0/94 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EVEETLKRIQSHKGVVGTIVVNNEGIPVKSTLDNTTTVQYAGLMSQLADKARSVVRDLDPSNDMT 68
            ||||||||:||.|||.|.||||.||||:|||:||.||.|||.||.....||||.||::||.||:|
Mouse    11 EVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYANLMHNFILKARSTVREIDPQNDLT 75

  Fly    69 FLRVRSKKHEIMVAPDKDFILIVIQNPTD 97
            |||:||||:|||||||||:.||||||||:
Mouse    76 FLRIRSKKNEIMVAPDKDYFLIVIQNPTE 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roblNP_523771.1 Robl_LC7 4..94 CDD:397386 65/89 (73%)
Dynlrb1NP_001278037.1 Robl_LC7 12..99 CDD:214939 62/86 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833548
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4115
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53580
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003157
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101498
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3930
SonicParanoid 1 1.000 - - X2120
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.640

Return to query results.
Submit another query.