DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl and robls54B

DIOPT Version :9

Sequence 1:NP_523771.1 Gene:robl / 36963 FlyBaseID:FBgn0024196 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001097356.1 Gene:robls54B / 5740248 FlyBaseID:FBgn0263233 Length:112 Species:Drosophila melanogaster


Alignment Length:93 Identity:28/93 - (30%)
Similarity:54/93 - (58%) Gaps:0/93 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VEETLKRIQSHKGVVGTIVVNNEGIPVKSTLDNTTTVQYAGLMSQLADKARSVVRDLDPSNDMTF 69
            ||:....::|.|.|...:::|..|.||.||:|....||::|....:..:....:..:||::::..
  Fly    16 VEKAFDLVKSKKHVRDVVILNESGHPVMSTMDREDAVQFSGPFQAIRGRLERGMSKIDPTDELLM 80

  Fly    70 LRVRSKKHEIMVAPDKDFILIVIQNPTD 97
            ||:|::.:|:::.||....|:|:||..|
  Fly    81 LRIRTRTNEVLLVPDSKITLLVVQNAHD 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roblNP_523771.1 Robl_LC7 4..94 CDD:397386 25/88 (28%)
robls54BNP_001097356.1 Robl_LC7 16..103 CDD:214939 24/86 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4115
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1512428at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10779
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.