DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl and dynlrb1

DIOPT Version :9

Sequence 1:NP_523771.1 Gene:robl / 36963 FlyBaseID:FBgn0024196 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_957482.1 Gene:dynlrb1 / 394163 ZFINID:ZDB-GENE-040426-989 Length:96 Species:Danio rerio


Alignment Length:94 Identity:70/94 - (74%)
Similarity:82/94 - (87%) Gaps:0/94 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EVEETLKRIQSHKGVVGTIVVNNEGIPVKSTLDNTTTVQYAGLMSQLADKARSVVRDLDPSNDMT 68
            |||||:|||||.|||.|.|:||.||||:|||||||:|||||..:.||..|||.:|||:||.||:|
Zfish     3 EVEETIKRIQSQKGVQGIIIVNAEGIPIKSTLDNTSTVQYAANIHQLLMKARGIVRDIDPQNDLT 67

  Fly    69 FLRVRSKKHEIMVAPDKDFILIVIQNPTD 97
            ||||||||:|||:|||||:.||||||||:
Zfish    68 FLRVRSKKNEIMIAPDKDYFLIVIQNPTE 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roblNP_523771.1 Robl_LC7 4..94 CDD:397386 66/89 (74%)
dynlrb1NP_957482.1 Robl_LC7 5..93 CDD:281277 64/87 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576264
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4115
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53580
OrthoDB 1 1.010 - - D1512428at2759
OrthoFinder 1 1.000 - - FOG0003157
OrthoInspector 1 1.000 - - otm26441
orthoMCL 1 0.900 - - OOG6_101498
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3930
SonicParanoid 1 1.000 - - X2120
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.650

Return to query results.
Submit another query.