DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl and robl62A

DIOPT Version :9

Sequence 1:NP_523771.1 Gene:robl / 36963 FlyBaseID:FBgn0024196 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001261256.1 Gene:robl62A / 38170 FlyBaseID:FBgn0028567 Length:104 Species:Drosophila melanogaster


Alignment Length:75 Identity:27/75 - (36%)
Similarity:43/75 - (57%) Gaps:2/75 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GTIVVNNEGIPVKSTLDNTTTVQ--YAGLMSQLADKARSVVRDLDPSNDMTFLRVRSKKHEIMVA 82
            |.:|..|.|..:..|..:.||.|  ...|.:.....|:|.|||||..:.:.||||:::|||.:|:
  Fly    29 GFVVSENAGDSLLHTSFDLTTAQSIVKHLHASFLKLAQSCVRDLDTDDKLCFLRVKTRKHEFLVS 93

  Fly    83 PDKDFILIVI 92
            |::.|.:.|:
  Fly    94 PEEAFTVTVV 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roblNP_523771.1 Robl_LC7 4..94 CDD:397386 27/75 (36%)
robl62ANP_001261256.1 Robl_LC7 24..103 CDD:214939 26/73 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4115
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2020
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1512428at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10779
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.