DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl and Dynlrb2

DIOPT Version :9

Sequence 1:NP_523771.1 Gene:robl / 36963 FlyBaseID:FBgn0024196 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001101921.1 Gene:Dynlrb2 / 361415 RGDID:1306930 Length:96 Species:Rattus norvegicus


Alignment Length:94 Identity:72/94 - (76%)
Similarity:87/94 - (92%) Gaps:0/94 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EVEETLKRIQSHKGVVGTIVVNNEGIPVKSTLDNTTTVQYAGLMSQLADKARSVVRDLDPSNDMT 68
            |||||||||||||||:||:|||.||||:::||||:||||||||:.||..||:|.|||:||.||:|
  Rat     3 EVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHQLTMKAKSTVRDIDPQNDLT 67

  Fly    69 FLRVRSKKHEIMVAPDKDFILIVIQNPTD 97
            |||:|||||||||||||:::|||||||.:
  Rat    68 FLRIRSKKHEIMVAPDKEYLLIVIQNPCE 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roblNP_523771.1 Robl_LC7 4..94 CDD:397386 69/89 (78%)
Dynlrb2NP_001101921.1 Robl_LC7 3..93 CDD:397386 69/89 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337132
Domainoid 1 1.000 147 1.000 Domainoid score I4401
eggNOG 1 0.900 - - E1_KOG4115
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12601
Inparanoid 1 1.050 155 1.000 Inparanoid score I4221
OMA 1 1.010 - - QHG53580
OrthoDB 1 1.010 - - D1512428at2759
OrthoFinder 1 1.000 - - FOG0003157
OrthoInspector 1 1.000 - - oto98137
orthoMCL 1 0.900 - - OOG6_101498
Panther 1 1.100 - - LDO PTHR10779
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2120
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.