DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl and CG31275

DIOPT Version :9

Sequence 1:NP_523771.1 Gene:robl / 36963 FlyBaseID:FBgn0024196 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_732175.1 Gene:CG31275 / 326131 FlyBaseID:FBgn0063261 Length:101 Species:Drosophila melanogaster


Alignment Length:77 Identity:28/77 - (36%)
Similarity:45/77 - (58%) Gaps:2/77 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VGTIVVNNEGIPVKSTLDNTTTVQ--YAGLMSQLADKARSVVRDLDPSNDMTFLRVRSKKHEIMV 81
            :|.:|.:|....|..|..:.|:.|  ...|...|....:|||||:||||.:.|:|:.::|.|.:|
  Fly    25 IGYVVSDNTANAVAETSFDNTSAQAILKHLHGLLVSTCQSVVRDIDPSNKLCFMRLGTRKFEYLV 89

  Fly    82 APDKDFILIVIQ 93
            ||::.|.:.|:|
  Fly    90 APEEYFTITVVQ 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roblNP_523771.1 Robl_LC7 4..94 CDD:397386 28/77 (36%)
CG31275NP_732175.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4115
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2020
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1512428at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10779
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.