DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl and dyrb-1

DIOPT Version :9

Sequence 1:NP_523771.1 Gene:robl / 36963 FlyBaseID:FBgn0024196 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_495943.1 Gene:dyrb-1 / 188872 WormBaseID:WBGene00012004 Length:95 Species:Caenorhabditis elegans


Alignment Length:91 Identity:45/91 - (49%)
Similarity:71/91 - (78%) Gaps:0/91 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EVEETLKRIQSHKGVVGTIVVNNEGIPVKSTLDNTTTVQYAGLMSQLADKARSVVRDLDPSNDMT 68
            :.|||::|:||.|||||.|||::.|..:.||:|:..|..:...:.||.:|.::.:|:||.|||:|
 Worm     3 DFEETIRRLQSEKGVVGIIVVDSAGRVIHSTIDSDATQSHTAFLQQLCEKTKTSIRELDSSNDLT 67

  Fly    69 FLRVRSKKHEIMVAPDKDFILIVIQN 94
            |||:|:||:|||:|||||.:::||::
 Worm    68 FLRLRTKKNEIMIAPDKDHVIMVIKD 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roblNP_523771.1 Robl_LC7 4..94 CDD:397386 45/89 (51%)
dyrb-1NP_495943.1 Robl_LC7 4..93 CDD:397386 45/88 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157560
Domainoid 1 1.000 101 1.000 Domainoid score I4363
eggNOG 1 0.900 - - E1_KOG4115
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I3549
Isobase 1 0.950 - 0 Normalized mean entropy S2020
OMA 1 1.010 - - QHG53580
OrthoDB 1 1.010 - - D1512428at2759
OrthoFinder 1 1.000 - - FOG0003157
OrthoInspector 1 1.000 - - otm14663
orthoMCL 1 0.900 - - OOG6_101498
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3930
SonicParanoid 1 1.000 - - X2120
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.690

Return to query results.
Submit another query.