DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl and Dynlrb1

DIOPT Version :9

Sequence 1:NP_523771.1 Gene:robl / 36963 FlyBaseID:FBgn0024196 Length:97 Species:Drosophila melanogaster
Sequence 2:XP_038960100.1 Gene:Dynlrb1 / 170714 RGDID:619910 Length:119 Species:Rattus norvegicus


Alignment Length:78 Identity:52/78 - (66%)
Similarity:62/78 - (79%) Gaps:0/78 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GTIVVNNEGIPVKSTLDNTTTVQYAGLMSQLADKARSVVRDLDPSNDMTFLRVRSKKHEIMVAPD 84
            |..|...:|||:|||:||.||.|||.||.....||||.||::||.||:||||:||||:|||||||
  Rat    42 GAAVSVRDGIPIKSTMDNPTTTQYANLMHNFILKARSTVREIDPQNDLTFLRIRSKKNEIMVAPD 106

  Fly    85 KDFILIVIQNPTD 97
            ||:.||||||||:
  Rat   107 KDYFLIVIQNPTE 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roblNP_523771.1 Robl_LC7 4..94 CDD:397386 48/73 (66%)
Dynlrb1XP_038960100.1 Robl_LC7 42..114 CDD:214939 46/71 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337131
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4115
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53580
OrthoDB 1 1.010 - - D1512428at2759
OrthoFinder 1 1.000 - - FOG0003157
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101498
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2120
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.660

Return to query results.
Submit another query.