DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl and dynlrb1

DIOPT Version :9

Sequence 1:NP_523771.1 Gene:robl / 36963 FlyBaseID:FBgn0024196 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001093687.1 Gene:dynlrb1 / 100101695 XenbaseID:XB-GENE-489076 Length:96 Species:Xenopus tropicalis


Alignment Length:94 Identity:67/94 - (71%)
Similarity:79/94 - (84%) Gaps:0/94 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EVEETLKRIQSHKGVVGTIVVNNEGIPVKSTLDNTTTVQYAGLMSQLADKARSVVRDLDPSNDMT 68
            :|||||||||..|||.|.|:||:||||:|||:||.||||||.||.||..|||..|||:|..||:|
 Frog     3 DVEETLKRIQGQKGVQGIIIVNSEGIPIKSTMDNQTTVQYASLMHQLVMKARGSVRDIDCQNDLT 67

  Fly    69 FLRVRSKKHEIMVAPDKDFILIVIQNPTD 97
            |||:||||:|||:|||||:.|||||.||:
 Frog    68 FLRIRSKKNEIMIAPDKDYFLIVIQQPTE 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roblNP_523771.1 Robl_LC7 4..94 CDD:397386 64/89 (72%)
dynlrb1NP_001093687.1 Robl_LC7 5..92 CDD:308728 62/86 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53580
OrthoDB 1 1.010 - - D1512428at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3930
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.