DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robl and dynlrb2

DIOPT Version :9

Sequence 1:NP_523771.1 Gene:robl / 36963 FlyBaseID:FBgn0024196 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001289961.1 Gene:dynlrb2 / 100001191 ZFINID:ZDB-GENE-120709-101 Length:96 Species:Danio rerio


Alignment Length:94 Identity:67/94 - (71%)
Similarity:85/94 - (90%) Gaps:0/94 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EVEETLKRIQSHKGVVGTIVVNNEGIPVKSTLDNTTTVQYAGLMSQLADKARSVVRDLDPSNDMT 68
            |||:||||||:..||:||||||.||||:::||||:|:||||||:.||..||||.|||:||.|::|
Zfish     3 EVEDTLKRIQAQHGVIGTIVVNGEGIPIRTTLDNSTSVQYAGLLHQLTMKARSAVRDIDPQNELT 67

  Fly    69 FLRVRSKKHEIMVAPDKDFILIVIQNPTD 97
            |||:|||||||||||||:::||.||||::
Zfish    68 FLRIRSKKHEIMVAPDKEYLLIAIQNPSE 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roblNP_523771.1 Robl_LC7 4..94 CDD:397386 64/89 (72%)
dynlrb2NP_001289961.1 Robl_LC7 5..93 CDD:281277 62/87 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576265
Domainoid 1 1.000 138 1.000 Domainoid score I4803
eggNOG 1 0.900 - - E1_KOG4115
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12601
Inparanoid 1 1.050 146 1.000 Inparanoid score I4397
OMA 1 1.010 - - QHG53580
OrthoDB 1 1.010 - - D1512428at2759
OrthoFinder 1 1.000 - - FOG0003157
OrthoInspector 1 1.000 - - otm26441
orthoMCL 1 0.900 - - OOG6_101498
Panther 1 1.100 - - LDO PTHR10779
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2120
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.